LXL04_036610 | RubberDandelionOmics

Gene overview

LXL04_036610

Reference: OH-1004 Chr: Chr08 Coordinates: 45414739-45417095 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1668 bp · LXL04_036610|LXL04_036610|OH1004|cDNA

ATGATTTTAATTGTTCGAGCTCTCTTGCTTTTCTCCCTTGCTTTTACTACATTCGCAGAAATACACCACCATGAGTTTAAAGTTCAAGAACTAGCTGTACGGAGGCTTTGTAGAAACCATAGAGTAGTAATGGTCAACGGACAGTTTCCAGGACCGACTCTACAAGTAAGAAATGGCGACAGTCTTGTTGTCAAAGTCACAAATGCTGCTCCTTATAATGTCACAATCCATTGGCATGGAATTCGTCAACTGAGAAACCC...

CDS

Download CDS FASTA

1668 bp · LXL04_036610|LXL04_036610|OH1004|CDS

ATGATTTTAATTGTTCGAGCTCTCTTGCTTTTCTCCCTTGCTTTTACTACATTCGCAGAAATACACCACCATGAGTTTAAAGTTCAAGAACTAGCTGTACGGAGGCTTTGTAGAAACCATAGAGTAGTAATGGTCAACGGACAGTTTCCAGGACCGACTCTACAAGTAAGAAATGGCGACAGTCTTGTTGTCAAAGTCACAAATGCTGCTCCTTATAATGTCACAATCCATTGGCATGGAATTCGTCAACTGAGAAACCC...

Protein

Download Protein FASTA

555 aa · LXL04_036610|LXL04_036610|OH1004|PROTEIN

MILIVRALLLFSLAFTTFAEIHHHEFKVQELAVRRLCRNHRVVMVNGQFPGPTLQVRNGDSLVVKVTNAAPYNVTIHWHGIRQLRNPWADGPEYVTQCPIQPGGSYTYRFTITDQEGTLWWHAHSRWLRTTVYGALVIRPKLGSPYPFPTPKIEFPVVLGEWWDRKVISVLRQALFTGAAPNVSDAITINGQPGDLFRCSSQGTTKLIVNQGDTVLLRVINAALNQQLFFSVANHQLTVVATDAVYTKQFTTNVIMVGPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036610`
TK1151 ID	TkA04G033890
OH-1004 ID	LXL04_036610
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036610

Location Chr08:45414739-45417095 (-)

Description Similar to LAC3: Laccase-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30210`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`At5g07130`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`At5g05390`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`At2g40370`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0827300`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036610 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046274 lignin catabolic process Biological Process

GO:0046688 response to copper ion Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0048226 Casparian strip Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0052716 hydroquinone:oxygen oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT2G30210

ath:AT2G40370

ath:AT5G05390

ath:AT5G07130

dosa:Os01g0827300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.961

Rank 1 · LXL04_036610 · OH-1004

Cytoplasm0.019

Rank 2 · LXL04_036610 · OH-1004

Cell membrane0.014

Rank 3 · LXL04_036610 · OH-1004

Endoplasmic reticulum0.009

Rank 4 · LXL04_036610 · OH-1004

Nucleus0.006

Rank 5 · LXL04_036610 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732.22Cu-oxidase_328-141 aa

PF00394.29Cu-oxidase155-304 aa

PF07731.21Cu-oxidase_2404-537 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036610	`PF07732.22`	Cu-oxidase_3	28	141	4.7e-46	156.4
LXL04_036610	`PF00394.29`	Cu-oxidase	155	304	6.3e-45	153.8
LXL04_036610	`PF07731.21`	Cu-oxidase_2	404	537	2.8e-46	157.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YT0`	Arabidopsis thaliana	Laccase-3	67.742%	Swiss-Prot	strong database homology
`Q9LYQ2`	Arabidopsis thaliana	Laccase-13	66.785%	Swiss-Prot	strong database homology
`Q9FLB5`	Arabidopsis thaliana	Laccase-12	64.811%	Swiss-Prot	strong database homology
`Q9SIY8`	Arabidopsis thaliana	Laccase-5	62.522%	Swiss-Prot	strong database homology
`Q941X2`	Oryza sativa subsp. japonica	Laccase-3	64.247%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card