LXL04_036258 | RubberDandelionOmics

Gene overview

LXL04_036258

Reference: OH-1004 Chr: Chr08 Coordinates: 38698142-38700086 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_036258|LXL04_036258|OH1004|cDNA

ATGGCAGAGATGGATGAATTCGATTTCATGGGCAGATGGAGTAATGACGTTATAGGCGTCGATGTGAGAGCAGCGATTGATGGAGTTATGGCATGCCTCTGGGTTTATGCTTATTGTTTAGTCCATGCTTTGACCGGTATCATGTCAGATTCTATCGTCGGCGACAACCAATTCAACCACCCAAACACACGGCGGAGAATTTGCAATGTCTGCGAAAGGCCAGCGACGGTGTGCCTATGTGACATAATTCCGTCTGAGCC...

CDS

Download CDS FASTA

912 bp · LXL04_036258|LXL04_036258|OH1004|CDS

ATGGCAGAGATGGATGAATTCGATTTCATGGGCAGATGGAGTAATGACGTTATAGGCGTCGATGTGAGAGCAGCGATTGATGGAGTTATGGCATGCCTCTGGGTTTATGCTTATTGTTTAGTCCATGCTTTGACCGGTATCATGTCAGATTCTATCGTCGGCGACAACCAATTCAACCACCCAAACACACGGCGGAGAATTTGCAATGTCTGCGAAAGGCCAGCGACGGTGTGCCTATGTGACATAATTCCGTCTGAGCC...

Protein

Download Protein FASTA

303 aa · LXL04_036258|LXL04_036258|OH1004|PROTEIN

MAEMDEFDFMGRWSNDVIGVDVRAAIDGVMACLWVYAYCLVHALTGIMSDSIVGDNQFNHPNTRRRICNVCERPATVCLCDIIPSEPLSTGTEIVILQHPHEQRHPLATVPVLNKCLRSCQTLIGRRLRRGHSALLDSLHDAAAEENPNEPRHAAFLFPGTDLNPSMDINQWKSSFGDDDSNKFILIAFDGTWKHAKEMVCASFPFLSKFATQVCLTYDVTVDGGTIYNSDLILRKEPFGGCMSTMEAVARSLRILEPNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036258`
TK1151 ID	TkA04G060070
OH-1004 ID	LXL04_036258
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 84.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036258

Location Chr08:38698142-38700086 (+)

Description Similar to DTWD2: tRNA-uridine aminocarboxypropyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41750`	Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20a in the D-loop of several cytoplasmic tRNAs (acp3U(20a)).	Identification of the enzymes responsible for m2,2G and acp3U formation on cytosolic tRNA from insects and plants.2020 · DOI: 10.1371/journal.pone.0242737

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036258 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006400 tRNA modification Biological Process

GO:0141217 glycoRNA biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016432 tRNA-uridine aminocarboxypropyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G41750

dme:Dmel_CG10050

hsa:285605

mmu:68857

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.558

Rank 1 · LXL04_036258 · OH-1004

Cytoplasm0.315

Rank 2 · LXL04_036258 · OH-1004

Plastid0.136

Rank 3 · LXL04_036258 · OH-1004

Mitochondrion0.071

Rank 4 · LXL04_036258 · OH-1004

Cell membrane0.040

Rank 5 · LXL04_036258 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03942.21DTW65-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036258	`PF03942.21`	DTW	65	278	2.7e-38	132.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IL05`	Arabidopsis thaliana	tRNA-uridine aminocarboxypropyltransferase A	48.178%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card