LXL04_036257 | RubberDandelionOmics

Gene overview

LXL04_036257

Reference: OH-1004 Chr: Chr08 Coordinates: 38685384-38688152 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2442 bp · LXL04_036257|LXL04_036257|OH1004|cDNA

ATGGCTGCTGAAGCTTTGATCGGAGCTGGGGTAGGAGACGCCGTTTCTAAGTTATCAGATGCCATCATACACGTATTAAAAACAACCTGGCAGTTTAGATCCAAACTCACTCAAATACAAGAAACCATAACGAGTAACAAACTGATCTTCGACGAAATCGAGAAACTAATTGAAGAATTGGATCGACCGAAAGAGGAAAAGGAGAAGTTCGTCGCTCAGATGAAAGGCGCGGAAGCTCTCGTTCTCAAATGCGAGCAAAT...

CDS

Download CDS FASTA

2442 bp · LXL04_036257|LXL04_036257|OH1004|CDS

ATGGCTGCTGAAGCTTTGATCGGAGCTGGGGTAGGAGACGCCGTTTCTAAGTTATCAGATGCCATCATACACGTATTAAAAACAACCTGGCAGTTTAGATCCAAACTCACTCAAATACAAGAAACCATAACGAGTAACAAACTGATCTTCGACGAAATCGAGAAACTAATTGAAGAATTGGATCGACCGAAAGAGGAAAAGGAGAAGTTCGTCGCTCAGATGAAAGGCGCGGAAGCTCTCGTTCTCAAATGCGAGCAAAT...

Protein

Download Protein FASTA

813 aa · LXL04_036257|LXL04_036257|OH1004|PROTEIN

MAAEALIGAGVGDAVSKLSDAIIHVLKTTWQFRSKLTQIQETITSNKLIFDEIEKLIEELDRPKEEKEKFVAQMKGAEALVLKCEQIKWRFWKKYHHALKLDDLNASLLRFCQIDLQLMMMRGVMDLLVAKDVQMRMMKGDAARWSSGTPLLKGVVIGFDDRLRDLKAMVLKEASGDECSVVVVSAAGGSGKTTLATMLCHDSAIQEKFGRNIYFATISEIPNLKIAVQNLLQTNQAGQKFDFINDDEAISQWGRFLAEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036257`
TK1151 ID	TkA04G060100
OH-1004 ID	LXL04_036257
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036257

Location Chr08:38685384-38688152 (+)

Description Similar to At5g66900: Probable disease resistance protein At5g66900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66900`	Probable disease resistance protein.	No verified direct reference in this release
`At5g66910`	Probable disease resistance protein.	No verified direct reference in this release
`At4g33300`	Probable disease resistance protein.	No verified direct reference in this release
`At5g47280`	Potential disease resistance protein.	No verified direct reference in this release
`At5g04720`	Probable disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036257 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G33300

ath:AT5G04720

ath:AT5G47280

ath:AT5G66900

ath:AT5G66910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.606

Rank 1 · LXL04_036257 · OH-1004

Cytoplasm0.234

Rank 2 · LXL04_036257 · OH-1004

Nucleus0.150

Rank 3 · LXL04_036257 · OH-1004

Endoplasmic reticulum0.111

Rank 4 · LXL04_036257 · OH-1004

Extracellular0.062

Rank 5 · LXL04_036257 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05659.17RPW84-130 aa

PF00931.29NB-ARC175-324 aa

PF23598.2LRR_14550-696 aa

PF23598.2LRR_14690-770 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036257	`PF05659.17`	RPW8	4	130	5.8e-24	85.0
LXL04_036257	`PF00931.29`	NB-ARC	175	324	4.4e-12	46.6
LXL04_036257	`PF23598.2`	LRR_14	550	696	1.9e-12	47.4
LXL04_036257	`PF23598.2`	LRR_14	690	770	1.9e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKZ1`	Arabidopsis thaliana	Probable disease resistance protein At5g66900	37.654%	Swiss-Prot	moderate database homology
`Q9FKZ0`	Arabidopsis thaliana	Probable disease resistance protein At5g66910	35.118%	Swiss-Prot	moderate database homology
`Q9SZA7`	Arabidopsis thaliana	Probable disease resistance protein At4g33300	35.063%	Swiss-Prot	moderate database homology
`Q9LVT1`	Arabidopsis thaliana	Putative disease resistance protein At5g47280	33.706%	Swiss-Prot	moderate database homology
`Q9LZ25`	Arabidopsis thaliana	Probable disease resistance protein At5g04720	32.619%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card