LXL04_036255 | RubberDandelionOmics

Gene overview

LXL04_036255

Reference: OH-1004 Chr: Chr08 Coordinates: 38669502-38673896 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4149 bp · LXL04_036255|LXL04_036255|OH1004|cDNA

ATGGCGTCTTTGGTTTCAACGCCATTTACATTACCCACAACCAAAGCCGACAAATTATCTTCAATTTCACAAAAACACTACTTTCTCCACTCCTTTCTACCAAAAAAATCGCCACATTTTCCTAAAACACCGAGTTTGGGTGTGAAATGCGCTGTTGTCGGAAACGGCCTTTTTACCCAAACCACACAGGAAGTCCGAAGGATCGTACCTGAAAACAAACAGGGCCTTCCGACTGTGAAGATCGTGTATGTGGTGTTAGA...

CDS

Download CDS FASTA

4149 bp · LXL04_036255|LXL04_036255|OH1004|CDS

ATGGCGTCTTTGGTTTCAACGCCATTTACATTACCCACAACCAAAGCCGACAAATTATCTTCAATTTCACAAAAACACTACTTTCTCCACTCCTTTCTACCAAAAAAATCGCCACATTTTCCTAAAACACCGAGTTTGGGTGTGAAATGCGCTGTTGTCGGAAACGGCCTTTTTACCCAAACCACACAGGAAGTCCGAAGGATCGTACCTGAAAACAAACAGGGCCTTCCGACTGTGAAGATCGTGTATGTGGTGTTAGA...

Protein

Download Protein FASTA

1382 aa · LXL04_036255|LXL04_036255|OH1004|PROTEIN

MASLVSTPFTLPTTKADKLSSISQKHYFLHSFLPKKSPHFPKTPSLGVKCAVVGNGLFTQTTQEVRRIVPENKQGLPTVKIVYVVLEAQYQSSLSAAVRTLNSSNKFASYEVVGYLVEELRDENNYKSFCLDLEDANIFIGSLIFVEELALKVKDAVEKQRDRMDAVLVFPSMPEVMRLNKLGSFSMSQLGQSKSPFFQLFKNKKKSSAGFSDQMLKLVRTLPKVLKYLPSDKAQDARLYILSLQFWLGGSPDNLVNFVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036255`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036255

Location Chr08:38669502-38673896 (+)

Description Similar to CHLH: Magnesium-chelatase subunit ChlH, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13630`	Multifunctional protein involved in chlorophyll synthesis, plastid-to-nucleus retrograde signaling and abscisic acid (ABA) perception.	Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastid-to-nucleus signal transduction.2001 · DOI: 10.1073/pnas.98.4.2053 The Mg-chelatase H subunit is an abscisic acid receptor.2006 · DOI: 10.1038/nature05176 The magnesium-chelatase H subunit binds abscisic acid and functions in abscisic acid signaling: new evidence in Arabidopsis.2009 · DOI: 10.1104/pp.109.140731 The Mg-chelatase H subunit of Arabidopsis antagonizes a group of WRKY transcription repressors to relieve ABA-responsive genes of inhibition.2010 · DOI: 10.1105/tpc.110.073874 Mg-chelatase H subunit affects ABA signaling in stomatal guard cells, but is not an ABA receptor in Arabidopsis thaliana.2011 · DOI: 10.1007/s10265-011-0426-x Roles of the different components of magnesium chelatase in abscisic acid signal transduction.2012 · DOI: 10.1007/s11103-012-9965-3

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8ANF1`	Involved in chlorophyll biosynthesis.	No verified direct reference in this release
`Os03g0323200`	Involved in chlorophyll biosynthesis.	C-terminal residues of oryza sativa GUN4 are required for the activation of the ChlH subunit of magnesium chelatase in chlorophyll synthesis.2012 · DOI: 10.1016/j.febslet.2011.12.026

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036255 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0036070 light-independent bacteriochlorophyll biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0010007 magnesium chelatase complex Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G13630

cpc:Cpar_0728

dosa:Os03g0323200

rsp:RSP_0287

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.368

Rank 1 · LXL04_036255 · OH-1004

Mitochondrion0.292

Rank 2 · LXL04_036255 · OH-1004

Cytoplasm0.181

Rank 3 · LXL04_036255 · OH-1004

Peroxisome0.095

Rank 4 · LXL04_036255 · OH-1004

Endoplasmic reticulum0.072

Rank 5 · LXL04_036255 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11965.14DUF347980-241 aa

PF02514.22CobN-Mg_chel245-1362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036255	`PF11965.14`	DUF3479	80	241	1.2e-48	165.9
LXL04_036255	`PF02514.22`	CobN-Mg_chel	245	1362		1223.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNB0`	Arabidopsis thaliana	Magnesium-chelatase subunit ChlH, chloroplastic	86.209%	Swiss-Prot	strong database homology
`B8ANF1`	Oryza sativa subsp. indica	Magnesium-chelatase subunit ChlH, chloroplastic	83.429%	Swiss-Prot	strong database homology
`Q10M50`	Oryza sativa subsp. japonica	Magnesium-chelatase subunit ChlH, chloroplastic	83.213%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card