LXL04_036247 | RubberDandelionOmics

Gene overview

LXL04_036247

Reference: OH-1004 Chr: Chr08 Coordinates: 38546784-38548079 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

729 bp · LXL04_036247|LXL04_036247|OH1004|cDNA

ATGGTGGCGGAGATAGGTGGCGGCGACGGTGATGGTGGTCAGTTGTTGGTGGATTTTGTCACAAAGTCGTCTCCATCGCCGTTTCTCCTGAAGACGTACATGTTGGTTGATGATCCAGCTACCGATCATGTCGTGTCTTGGAACTCCGGCGGGACTGGGTTTGTGGTTTGGCAGCCGGCGGAGTTCGCCGGAGACTTGCTCCCGACACTGTTTAAACACAGCAATTTCTGTAGCTTCGTTCGCCAACTCAATACTTACGG...

CDS

Download CDS FASTA

729 bp · LXL04_036247|LXL04_036247|OH1004|CDS

ATGGTGGCGGAGATAGGTGGCGGCGACGGTGATGGTGGTCAGTTGTTGGTGGATTTTGTCACAAAGTCGTCTCCATCGCCGTTTCTCCTGAAGACGTACATGTTGGTTGATGATCCAGCTACCGATCATGTCGTGTCTTGGAACTCCGGCGGGACTGGGTTTGTGGTTTGGCAGCCGGCGGAGTTCGCCGGAGACTTGCTCCCGACACTGTTTAAACACAGCAATTTCTGTAGCTTCGTTCGCCAACTCAATACTTACGG...

Protein

Download Protein FASTA

242 aa · LXL04_036247|LXL04_036247|OH1004|PROTEIN

MVAEIGGGDGDGGQLLVDFVTKSSPSPFLLKTYMLVDDPATDHVVSWNSGGTGFVVWQPAEFAGDLLPTLFKHSNFCSFVRQLNTYGFRKISTTRWEFCNERFHKGRKELLCQIRRRKSWTNKSQPITQTLKESDEDQRSSSTNSLSSGYNILVDENHKLKKENKVLGSELLSIKKKCKELIDLVGMYTSSSSKKEDEEDERPMLFGVRLEVNGDHMERKRKRIEEVSESARRILLSVNVNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036247`
TK1151 ID	TkA04G060720
OH-1004 ID	LXL04_036247
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036247

Location Chr08:38546784-38548079 (+)

Description Similar to HSFB3: Heat stress transcription factor B-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41690`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At1g46264`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0568700`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os08g0546800`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036247 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G46264

ath:AT2G41690

dosa:Os04g0568700

dosa:Os08g0546800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · LXL04_036247 · OH-1004

Cytoplasm0.092

Rank 2 · LXL04_036247 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_036247 · OH-1004

Mitochondrion0.010

Rank 4 · LXL04_036247 · OH-1004

Plastid0.009

Rank 5 · LXL04_036247 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447.24HSF_DNA-bind28-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036247	`PF00447.24`	HSF_DNA-bind	28	117	3.6e-28	98.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22230`	Arabidopsis thaliana	Heat stress transcription factor B-3	55.288%	Swiss-Prot	strong database homology
`Q9C635`	Arabidopsis thaliana	Heat stress transcription factor B-4	44.231%	Swiss-Prot	moderate database homology
`Q7XRX3`	Oryza sativa subsp. japonica	Heat stress transcription factor B-2a	42.308%	Swiss-Prot	moderate database homology
`Q6Z9C8`	Oryza sativa subsp. japonica	Heat stress transcription factor B-2b	42.157%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card