RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_036127
Reference: OH-1004 Chr: Chr08 Coordinates: 36160218-36167151 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4230 bp · LXL04_036127|LXL04_036127|OH1004|cDNA

ATGTCGATTCTGCAAGAACTGGACCACCTTAGAATTCCGCTCGAAGACATAAAACAGGCAACCAACAATTTTGATCGTAGAAATATCATCGGACCGCGTGTTTACTACGGGGTGGTGTACGCAGGAGTACTTTTACACTTAAATGGGCCTACTAAGATTGTAGCAAGGCGAATTGATCGGAGTGCAAGTCATGATGAAAAGCATTTTTTAAATGAGATCAGAGTGCTCACtttatataaacatgttaatGTTGTCTCATT...

CDS

Download CDS FASTA

4230 bp · LXL04_036127|LXL04_036127|OH1004|CDS

ATGTCGATTCTGCAAGAACTGGACCACCTTAGAATTCCGCTCGAAGACATAAAACAGGCAACCAACAATTTTGATCGTAGAAATATCATCGGACCGCGTGTTTACTACGGGGTGGTGTACGCAGGAGTACTTTTACACTTAAATGGGCCTACTAAGATTGTAGCAAGGCGAATTGATCGGAGTGCAAGTCATGATGAAAAGCATTTTTTAAATGAGATCAGAGTGCTCACTTTATATAAACATGTTAATGTTGTCTCATT...

Protein

Download Protein FASTA

1409 aa · LXL04_036127|LXL04_036127|OH1004|PROTEIN

MSILQELDHLRIPLEDIKQATNNFDRRNIIGPRVYYGVVYAGVLLHLNGPTKIVARRIDRSASHDEKHFLNEIRVLTLYKHVNVVSFMGFCDEGDEKILVEEFVTCKGLDKFLSNSKLKWLQRLQICLGAARGLNHLHNGVEGHTLIHHSIRSRNIVLDENWQPKIAHLSHSILDQLHHTTDQRIIGKIAYIDPTFLQTGIVTKESDIYSFGVVLFEVLCGRLAYERKEDQIQYLCPLATHHYEDGKLNEIIDPLLRKQM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_036127
TK1151 IDTkA04G073080
OH-1004 IDLXL04_036127
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_036127
LocationChr08:36160218-36167151 (-)
DescriptionSimilar to ANX2: Receptor-like protein kinase ANXUR2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At2g39360 Probable receptor-like protein kinase At2g39360. No verified direct reference in this release
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036127 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0010183 pollen tube guidance Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0016324 apical plasma membrane Cellular Component
GO:0043680 filiform apparatus Cellular Component
GO:0090404 pollen tube tip Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT5G28680
ath:AT5G59700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576
Rank 1 · LXL04_036127 · OH-1004
Nucleus0.306
Rank 2 · LXL04_036127 · OH-1004
Cell membrane0.275
Rank 3 · LXL04_036127 · OH-1004
Endoplasmic reticulum0.049
Rank 4 · LXL04_036127 · OH-1004
Lysosome / Vacuole0.043
Rank 5 · LXL04_036127 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr36-293 aa
PF00069.32Pkinase52-292 aa
PF07714.24PK_Tyr_Ser-Thr355-660 aa
PF00069.32Pkinase395-658 aa
PF07714.24PK_Tyr_Ser-Thr690-957 aa
PF00069.32Pkinase695-955 aa
PF14299.14PP21035-1162 aa
PF14299.14PP21247-1408 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_036127PF07714.24PK_Tyr_Ser-Thr362939.8e-103343.7
LXL04_036127PF00069.32Pkinase522921.2e-83281.2
LXL04_036127PF07714.24PK_Tyr_Ser-Thr3556609.8e-103343.7
LXL04_036127PF00069.32Pkinase3956581.2e-83281.2
LXL04_036127PF07714.24PK_Tyr_Ser-Thr6909579.8e-103343.7
LXL04_036127PF00069.32Pkinase6959551.2e-83281.2
LXL04_036127PF14299.14PP2103511626.9e-35120.9
LXL04_036127PF14299.14PP2124714086.9e-35120.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q3E8W4Arabidopsis thalianaReceptor-like protein kinase ANXUR240.491%Swiss-Protweak database homology
Q9FN92Arabidopsis thalianaProbable receptor-like protein kinase At5g5970039.091%Swiss-Protweak database homology
Q9LX66Arabidopsis thalianaReceptor-like protein kinase HERK 138.788%Swiss-Protweak database homology
O80623Arabidopsis thalianaProbable receptor-like protein kinase At2g3936038.643%Swiss-Protweak database homology
Q9FID8Arabidopsis thalianaPutative receptor-like protein kinase At5g3900037.690%Swiss-Protweak database homology

JBrowse

View in Genome Browser