Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1038 bp · LXL04_036125|LXL04_036125|OH1004|cDNA
ATGGGCGTGGATTACTATAAGGTTCTTCAAGTGGACCGCAGCGCTAAAGACGATGATTTGAAGAAAGCATATCGGAAACTCGCTATGAAGTGGCACCCTGATAAGAACCCCAATAACAAAAAAGATGCCGAAGCCAAATTCAAAACAATCTCCGAAGCCTACGATGTATTAAGCGATCCACAAAAGAGAGCAATTTATGATCAATATGGTGAAGAGGGACTAAAGGGGCAGGTGCCACCACCTGGATCCGGCGGCTTTTC...
1038 bp · LXL04_036125|LXL04_036125|OH1004|CDS
ATGGGCGTGGATTACTATAAGGTTCTTCAAGTGGACCGCAGCGCTAAAGACGATGATTTGAAGAAAGCATATCGGAAACTCGCTATGAAGTGGCACCCTGATAAGAACCCCAATAACAAAAAAGATGCCGAAGCCAAATTCAAAACAATCTCCGAAGCCTACGATGTATTAAGCGATCCACAAAAGAGAGCAATTTATGATCAATATGGTGAAGAGGGACTAAAGGGGCAGGTGCCACCACCTGGATCCGGCGGCTTTTC...
Protein
Download Protein FASTA345 aa · LXL04_036125|LXL04_036125|OH1004|PROTEIN
MGVDYYKVLQVDRSAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKTISEAYDVLSDPQKRAIYDQYGEEGLKGQVPPPGSGGFSGMPHDGGSTTFRFNPRNADDIFSEFFGFSSPFGGMGGGSHSHSGSPFQRGMFGDDIFSQFRGASGHGGEGSASMPPRKGAMIERMLPCSLEDLFKGTTKKMKISRDVSDGTGRSTTVEEILTIEIKPGWKKGTKITFPEKGNEQRGVIPSDLVFIIDEKPHALFKRDGNDLVV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036125 |
|---|---|
| TK1151 ID | TkA04G073510 |
| OH-1004 ID | LXL04_036125 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036125 |
|---|---|
| Location | Chr08:36109153-36111931 (-) |
| Description | Similar to Dnajb13: DnaJ homolog subfamily B member 13 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0003341 cilium movement Biological Process GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process GO:0006457 protein folding Biological Process GO:0006986 response to unfolded protein Biological Process GO:0007618 mating Biological Process GO:0009408 response to heat Biological Process GO:0030317 flagellated sperm motility Biological Process GO:1904158 axonemal central apparatus assembly Biological Process GO:0001534 radial spoke Cellular Component GO:0005576 extracellular region Cellular Component GO:0005654 nucleoplasm Cellular Component |
| KEGG gene cross-reference | hsa:11080 hsa:374407 mmu:67035 mmu:69387 pon:100174554 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00226.37DnaJ4-67 aaPF01556.24DnaJ_C170-327 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036125 | PF00226.37 | DnaJ | 4 | 67 | 2e-27 | 95.8 |
| LXL04_036125 | PF01556.24 | DnaJ_C | 170 | 327 | 8.6e-41 | 140.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.