LXL04_036122 | RubberDandelionOmics

Gene overview

LXL04_036122

Reference: OH-1004 Chr: Chr08 Coordinates: 36078533-36079531 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · LXL04_036122|LXL04_036122|OH1004|cDNA

ATGACGGCGACAGTCGGAATTGACCTCGGAACCACATACTCATGTGTTGCTGTTTGGAGACACAACCGTGTAGAAATCATACCAAATGAACAAGGAAACAGAACTACACCTTCATGTGTTGCATTCACCGATTCAGAACGGTTTATCGGTGATGCCGCCCAGAATCAGATCGCAATGAATCCCGTCAATACCATATTCGATGCTAAGCGGTTTATCAGAAGGAGATTCAGTGACGACATAGTCCAGGCCGACAAGAATCT...

CDS

Download CDS FASTA

858 bp · LXL04_036122|LXL04_036122|OH1004|CDS

ATGACGGCGACAGTCGGAATTGACCTCGGAACCACATACTCATGTGTTGCTGTTTGGAGACACAACCGTGTAGAAATCATACCAAATGAACAAGGAAACAGAACTACACCTTCATGTGTTGCATTCACCGATTCAGAACGGTTTATCGGTGATGCCGCCCAGAATCAGATCGCAATGAATCCCGTCAATACCATATTCGATGCTAAGCGGTTTATCAGAAGGAGATTCAGTGACGACATAGTCCAGGCCGACAAGAATCT...

Protein

Download Protein FASTA

285 aa · LXL04_036122|LXL04_036122|OH1004|PROTEIN

MTATVGIDLGTTYSCVAVWRHNRVEIIPNEQGNRTTPSCVAFTDSERFIGDAAQNQIAMNPVNTIFDAKRFIRRRFSDDIVQADKNLYPFTITGGGLNDKPVILVTYKGEEKRFSPEEISSMVLSKMKETSETYLGTTVKNAVITVPAYFNDCQRQATKDAGTVAGLNILRMINEPTSAAIAYGLENRAGINGETNALIFDLGGGTFDVSLVNIGEGIFEVKATGGDSRLGGEDFDNAMVAHFVGEFKKTHKRDISKNPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036122`
TK1151 ID	TkA04G073540
OH-1004 ID	LXL04_036122
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.800
Protein coverage (%)	TK1151 84.848 / OH-1004 91.228 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036122

Location Chr08:36078533-36079531 (-)

Description Similar to HSP70: Heat shock cognate 70 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02490`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At3g09440`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At5g02500`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).	Physiological and molecular assessment of altered expression of Hsc70-1 in Arabidopsis. Evidence for pleiotropic consequences.2003 · DOI: 10.1104/pp.102.019398 Interaction between SGT1 and cytosolic/nuclear HSC70 chaperones regulates Arabidopsis immune responses.2007 · DOI: 10.1105/tpc.107.051896 WPP-domain proteins mimic the activity of the HSC70-1 chaperone in preventing mistargeting of RanGAP1-anchoring protein WIT1.2009 · DOI: 10.1104/pp.109.143404 The cytosolic/nuclear HSC70 and HSP90 molecular chaperones are important for stomatal closure and modulate abscisic acid-dependent physiological responses in Arabidopsis.2011 · DOI: 10.1104/pp.111.174425

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036122 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009615 response to virus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010286 heat acclimation Biological Process

GO:0042026 protein refolding Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0090332 stomatal closure Biological Process

KEGG gene cross-reference

ath:AT3G09440

ath:AT5G02490

ath:AT5G02500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · LXL04_036122 · OH-1004

Mitochondrion0.241

Rank 2 · LXL04_036122 · OH-1004

Nucleus0.240

Rank 3 · LXL04_036122 · OH-1004

Cell membrane0.059

Rank 4 · LXL04_036122 · OH-1004

Peroxisome0.058

Rank 5 · LXL04_036122 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012.27HSP705-280 aa

PF06723.20MreB_Mbl134-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036122	`PF00012.27`	HSP70	5	280	3.4e-119	399.5
LXL04_036122	`PF06723.20`	MreB_Mbl	134	244	2.4e-11	43.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P22954`	Arabidopsis thaliana	Heat shock 70 kDa protein 2	72.043%	Swiss-Prot	strong database homology
`O65719`	Arabidopsis thaliana	Heat shock 70 kDa protein 3	70.968%	Swiss-Prot	strong database homology
`P22953`	Arabidopsis thaliana	Heat shock 70 kDa protein 1	71.326%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card