LXL04_035937 | RubberDandelionOmics

Gene overview

LXL04_035937

Reference: OH-1004 Chr: Chr08 Coordinates: 32474767-32478058 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_035937|LXL04_035937|OH1004|cDNA

ATGTCAGGTTTGTATAATTCCAACTTTTCTCCATCAAGAGCCGTCTCTCCACAGATTAGAACTTATGGAGATGTCGATAGTCAGTATTTGTCGGAATTATTGGCGGAACATCAGAAGCTCCAGCCGTTTTTGCAAGTTCTTCCCGTATGCACCAGACTCTTGAATCAAGAAATTATGAGGGTTTCTGGTATGTTACAAAACCAAGGATTTAATGAGTTTGAAAGAATGCGACATAGAAGCCCAAGCCCCATGGCTTCTTC...

CDS

Download CDS FASTA

825 bp · LXL04_035937|LXL04_035937|OH1004|CDS

ATGTCAGGTTTGTATAATTCCAACTTTTCTCCATCAAGAGCCGTCTCTCCACAGATTAGAACTTATGGAGATGTCGATAGTCAGTATTTGTCGGAATTATTGGCGGAACATCAGAAGCTCCAGCCGTTTTTGCAAGTTCTTCCCGTATGCACCAGACTCTTGAATCAAGAAATTATGAGGGTTTCTGGTATGTTACAAAACCAAGGATTTAATGAGTTTGAAAGAATGCGACATAGAAGCCCAAGCCCCATGGCTTCTTC...

Protein

Download Protein FASTA

274 aa · LXL04_035937|LXL04_035937|OH1004|PROTEIN

MSGLYNSNFSPSRAVSPQIRTYGDVDSQYLSELLAEHQKLQPFLQVLPVCTRLLNQEIMRVSGMLQNQGFNEFERMRHRSPSPMASSDLMSHVPGGWNGLPQERLSGMTMDWQGAPASPSSYTVKRILRLDIPVDTFPNFNFVGRLLGPRGNSLKRIEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPPSVVDLRLRQAQEIIQELLKPVDESEDFIKRQQLRELALLNSTFREESPGPSGSMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035937`
TK1151 ID	TkA04G095130
OH-1004 ID	LXL04_035937
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035937

Location Chr08:32474767-32478058 (+)

Description Similar to At2g38610: KH domain-containing protein At2g38610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38610`	KH domain-containing protein At2g38610.	No verified direct reference in this release
`At3g08620`	KH domain-containing protein At3g08620.	No verified direct reference in this release
`At4g26480`	KH domain-containing protein At4g26480.	No verified direct reference in this release
`At5g56140`	KH domain-containing protein At5g56140.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0815700`	Involved in flowering time control.	SPIN1, a K homology domain protein negatively regulated and ubiquitinated by the E3 ubiquitin ligase SPL11, is involved in flowering time control in rice.2008 · DOI: 10.1105/tpc.108.058610

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035937 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009908 flower development Biological Process

GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process

GO:0048577 negative regulation of short-day photoperiodism, flowering Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G38610

ath:AT3G08620

ath:AT4G26480

ath:AT5G56140

dosa:Os03g0815700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.784

Rank 1 · LXL04_035937 · OH-1004

Cytoplasm0.383

Rank 2 · LXL04_035937 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_035937 · OH-1004

Cell membrane0.024

Rank 4 · LXL04_035937 · OH-1004

Endoplasmic reticulum0.017

Rank 5 · LXL04_035937 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16544.11STAR_dimer26-72 aa

PF22675.3KH-I_KHDC4-BBP138-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035937	`PF16544.11`	STAR_dimer	26	72	5.7e-15	55.3
LXL04_035937	`PF22675.3`	KH-I_KHDC4-BBP	138	224	1.2e-21	77.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVI3`	Arabidopsis thaliana	KH domain-containing protein At2g38610	79.720%	Swiss-Prot	strong database homology
`Q8GYR4`	Arabidopsis thaliana	KH domain-containing protein At3g08620	77.305%	Swiss-Prot	strong database homology
`Q0WLR1`	Arabidopsis thaliana	KH domain-containing protein At4g26480	58.964%	Swiss-Prot	strong database homology
`Q9FKT4`	Arabidopsis thaliana	KH domain-containing protein At5g56140	59.363%	Swiss-Prot	strong database homology
`Q75GR5`	Oryza sativa subsp. japonica	KH domain-containing protein SPIN1	70.463%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card