Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1521 bp · LXL04_035878|LXL04_035878|OH1004|cDNA
ATGTCTCTCCTTCTTCATCATCCATGTTGTAAGTTTCTGCCTCCCTTAGATACCTTCTTTATCTGCAAAACCCCCATTAACAGATTCATTTCTTTCCCTAAACCCCCCAAACACTTCGACAACCTACCTTCTCTTACCAAATACCCAATCTTTAGAACCACCCATGTTGTAAATTGCTCGAATAACGAAGTCATTGATGAATTTACAAACACTCAATTGGACCAAACTCAAGAAAATGAGATCGAAGAGCTTGGATTGTT...
1521 bp · LXL04_035878|LXL04_035878|OH1004|CDS
ATGTCTCTCCTTCTTCATCATCCATGTTGTAAGTTTCTGCCTCCCTTAGATACCTTCTTTATCTGCAAAACCCCCATTAACAGATTCATTTCTTTCCCTAAACCCCCCAAACACTTCGACAACCTACCTTCTCTTACCAAATACCCAATCTTTAGAACCACCCATGTTGTAAATTGCTCGAATAACGAAGTCATTGATGAATTTACAAACACTCAATTGGACCAAACTCAAGAAAATGAGATCGAAGAGCTTGGATTGTT...
Protein
Download Protein FASTA506 aa · LXL04_035878|LXL04_035878|OH1004|PROTEIN
MSLLLHHPCCKFLPPLDTFFICKTPINRFISFPKPPKHFDNLPSLTKYPIFRTTHVVNCSNNEVIDEFTNTQLDQTQENEIEELGLLGKPSPMPISVPPPPEVEDEHIKPQKEEVLEPFYKFFRDGKSVEDTSDSEDVSDEISIEEEEEEDKKVSVEYYDPKQGDFVVGVVVSGNEYKLDVNIGADLLGTMLTKEVLPLYDKELDNLLCDFEKNAEEFFTKGKIGIVRNQEALSGGPVAGQSVVEHGTVLFAEVLGRTLS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_035878 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_035878 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:31103087-31105376 (-) | |||||||||
| Description | Similar to PDE338: Protein PIGMENT DEFECTIVE 338, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006412 translation Biological Process GO:0009416 response to light stimulus Biological Process GO:0009657 plastid organization Biological Process GO:0010196 nonphotochemical quenching Biological Process GO:0032544 plastid translation Biological Process GO:0043489 RNA stabilization Biological Process GO:0045727 positive regulation of translation Biological Process GO:0005739 mitochondrion Cellular Component GO:0005840 ribosome Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G71720 ath:AT5G30510 syc:syc0836_d syn:slr1356 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF31157.1RLSB_S1166-274 aaPF00575.30S1363-422 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_035878 | PF31157.1 | RLSB_S1 | 166 | 274 | 5.8e-56 | 188.2 |
| LXL04_035878 | PF00575.30 | S1 | 363 | 422 | 4.4e-14 | 53.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.