LXL04_035650 | RubberDandelionOmics

Gene overview

LXL04_035650

Reference: OH-1004 Chr: Chr08 Coordinates: 26331043-26332037 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

795 bp · LXL04_035650|LXL04_035650|OH1004|cDNA

ATGAAGATCCCTGTGCTCGAGAATTTCATGTTTGATGAACCATCGGTTTGGATTACAATAACGACGGTGGTGACGTTGATTTCAACGGTTTACTTAGGTTTTTCAGAGATGATAGGGAATCATCTCCAGTATTCAAAATTTGCCGACGTTAAACCTTCAACAACACAAGGAACTAAGCTATCAAGCAGAACAGGTTTTTTGATTCTCTACACGCCGGCGTTCCTCGCCGGACTTGTTTCCTTCTTCGTCTTCCCTGGCGG...

CDS

Download CDS FASTA

795 bp · LXL04_035650|LXL04_035650|OH1004|CDS

ATGAAGATCCCTGTGCTCGAGAATTTCATGTTTGATGAACCATCGGTTTGGATTACAATAACGACGGTGGTGACGTTGATTTCAACGGTTTACTTAGGTTTTTCAGAGATGATAGGGAATCATCTCCAGTATTCAAAATTTGCCGACGTTAAACCTTCAACAACACAAGGAACTAAGCTATCAAGCAGAACAGGTTTTTTGATTCTCTACACGCCGGCGTTCCTCGCCGGACTTGTTTCCTTCTTCGTCTTCCCTGGCGG...

Protein

Download Protein FASTA

264 aa · LXL04_035650|LXL04_035650|OH1004|PROTEIN

MKIPVLENFMFDEPSVWITITTVVTLISTVYLGFSEMIGNHLQYSKFADVKPSTTQGTKLSSRTGFLILYTPAFLAGLVSFFVFPGGGIRFLLLKFAVTFHFFKRDLEVLFLHKYSGGMILGSTILISIFYLSAAASMIVVHYLSLGLPDPSIDLKYIGLILFLVGISGNFYHHKLLSKLRTANEKGYKIPHGGLFNLVICPHYLFEIIIFVGMSFISQTPLAFACTFGDSMYLIARSYETRKWYVNKFEDFPKNIKCVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035650`
TK1151 ID	TkA04G116590
OH-1004 ID	LXL04_035650
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035650

Location Chr08:26331043-26332037 (+)

Description Similar to DET2: Steroid 5-alpha-reductase DET2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38050`	Involved in a reduction step in the biosynthesis of the plant steroid, brassinolide (BL).	Arabidopsis det2 is defective in the conversion of (24R)-24-methylcholest-4-En-3-one to (24R)-24-methyl-5alpha-cholestan-3-one in brassinosteroid biosynthesis.1999 · DOI: 10.1104/pp.120.3.833 Brassinosteroids control the proliferation of leaf cells of Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf024 5alpha-Reductase activity in Lycopersicon esculentum: cloning and functional characterization of LeDET2 and evidence of the presence of two isoenzymes.2005 · DOI: 10.1016/j.jsbmb.2005.04.035 CYP90A1/CPD, a brassinosteroid biosynthetic cytochrome P450 of Arabidopsis, catalyzes C-3 oxidation.2012 · DOI: 10.1074/jbc.m112.392720 Brassinosteroid regulates seed size and shape in Arabidopsis.2013 · DOI: 10.1104/pp.113.217703 A role for brassinosteroids in light-dependent development of Arabidopsis.1996 · DOI: 10.1126/science.272.5260.398 Conservation of function between mammalian and plant steroid 5alpha-reductases.1997 · DOI: 10.1073/pnas.94.8.3554 The Arabidopsis deetiolated2 mutant is blocked early in brassinosteroid biosynthesis.1997 · DOI: 10.1105/tpc.9.11.1951

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035650 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006665 sphingolipid metabolic process Biological Process

GO:0006694 steroid biosynthetic process Biological Process

GO:0006702 androgen biosynthetic process Biological Process

GO:0007548 sex differentiation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0016132 brassinosteroid biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0061370 testosterone biosynthetic process Biological Process

GO:0090377 seed trichome initiation Biological Process

KEGG gene cross-reference

ath:AT2G38050

bdi:100827766

ddi:DDB_G0270270

ghi:107948867

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.868

Rank 1 · LXL04_035650 · OH-1004

Nucleus0.073

Rank 2 · LXL04_035650 · OH-1004

Cytoplasm0.065

Rank 3 · LXL04_035650 · OH-1004

Golgi apparatus0.054

Rank 4 · LXL04_035650 · OH-1004

Cell membrane0.038

Rank 5 · LXL04_035650 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02544.22Steroid_dh155-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035650	`PF02544.22`	Steroid_dh	155	264	1.6e-26	93.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38944`	Arabidopsis thaliana	Steroid 5-alpha-reductase DET2	35.185%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card