LXL04_035561 | RubberDandelionOmics

Gene overview

LXL04_035561

Reference: OH-1004 Chr: Chr08 Coordinates: 24529605-24530024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · LXL04_035561|LXL04_035561|OH1004|cDNA

ATGGCACCCAAGGCCGAGAAAAAGCCAGCGGAGAAGAAACCCGCAGCCGAGAAAGCTCCGGCGGAGAAGAAACCCAGAGCCGAGAAGAAGCTTCCGAAGGACGCCTCAGCGACtgacaagaagaagaagagaaacAAGAAGTCCGTGGAGACCTACAAGATCTACATCTTCAAGGTTCTGAAGCAGGTTCATCCCGATATCGGAATCTCCAGCAAAGCTATGGGAATCATGAACTCTTTCATCAATGATATTTTCGAGAA...

CDS

Download CDS FASTA

420 bp · LXL04_035561|LXL04_035561|OH1004|CDS

ATGGCACCCAAGGCCGAGAAAAAGCCAGCGGAGAAGAAACCCGCAGCCGAGAAAGCTCCGGCGGAGAAGAAACCCAGAGCCGAGAAGAAGCTTCCGAAGGACGCCTCAGCGACTGACAAGAAGAAGAAGAGAAACAAGAAGTCCGTGGAGACCTACAAGATCTACATCTTCAAGGTTCTGAAGCAGGTTCATCCCGATATCGGAATCTCCAGCAAAGCTATGGGAATCATGAACTCTTTCATCAATGATATTTTCGAGAA...

Protein

Download Protein FASTA

139 aa · LXL04_035561|LXL04_035561|OH1004|PROTEIN

MAPKAEKKPAEKKPAAEKAPAEKKPRAEKKLPKDASATDKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035561`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035561

Location Chr08:24529605-24530024 (-)

Description Similar to H2B-3: Histone H2B.3 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45980`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035561 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G45980

mtr:11417139

mtr:11442767

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · LXL04_035561 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_035561 · OH-1004

Extracellular0.031

Rank 3 · LXL04_035561 · OH-1004

Mitochondrion0.016

Rank 4 · LXL04_035561 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_035561 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone36-115 aa

PF26281.1Histone_ABTB69-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035561	`PF00125.31`	Histone	36	115	8.7e-21	74.8
LXL04_035561	`PF26281.1`	Histone_ABTB	69	138	3.7e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23629`	Arabidopsis thaliana	Histone H2B.6	86.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card