LXL04_035436 | RubberDandelionOmics

Gene overview

LXL04_035436

Reference: OH-1004 Chr: Chr08 Coordinates: 22463745-22465471 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · LXL04_035436|LXL04_035436|OH1004|cDNA

TGCTACAAACGCACGAAGAGGAAGTGCAGGTTGAGAACTATAACCCTATTGCCTACGATATTCGTTTATCCATTCGAACGATCCTCGATCTCAATTGATTCAATGGCAATGAACGGGGCTAGACGAGGATTCTCCATGACTTCCAATCTTCTGAAAGCCCTGAAAacctcttcttcttcatcgtcgCTCAGACCCTTCAGCAGCGTCGTTAACAGCGAAATCACCACCTCCCACACTGCCAAATGGATGCAGGATACAAG...

CDS

Download CDS FASTA

417 bp · LXL04_035436|LXL04_035436|OH1004|CDS

TTGAGAACTATAACCCTATTGCCTACGATATTCGTTTATCCATTCGAACGATCCTCGATCTCAATTGATTCAATGGCAATGAACGGGGCTAGACGAGGATTCTCCATGACTTCCAATCTTCTGAAAGCCCTGAAAACCTCTTCTTCTTCATCGTCGCTCAGACCCTTCAGCAGCGTCGTTAACAGCGAAATCACCACCTCCCACACTGCCAAATGGATGCAGGATACAAGCAAGAAATCTCCGATGGAGTTGATCAATGA...

Protein

Download Protein FASTA

138 aa · LXL04_035436|LXL04_035436|OH1004|PROTEIN

MRTITLLPTIFVYPFERSSISIDSMAMNGARRGFSMTSNLLKALKTSSSSSSLRPFSSVVNSEITTSHTAKWMQDTSKKSPMELINEVPPIKIDGRIAVCEGDTDPALGHPFEFICLDKPEPAICKYCGLRFVQDHHH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035436`
TK1151 ID	TkA04G130940
OH-1004 ID	LXL04_035436
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 93.243 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035436

Location Chr08:22463745-22465471 (+)

Description Similar to At3g03070: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03070`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035436 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006936 muscle contraction Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0010467 gene expression Biological Process

GO:0017145 stem cell division Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0051881 regulation of mitochondrial membrane potential Biological Process

GO:0061458 reproductive system development Biological Process

KEGG gene cross-reference

ani:ANIA_08049

ath:AT3G03070

cel:CELE_F22D6.4

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.876

Rank 1 · LXL04_035436 · OH-1004

Plastid0.091

Rank 2 · LXL04_035436 · OH-1004

Cytoplasm0.049

Rank 3 · LXL04_035436 · OH-1004

Nucleus0.046

Rank 4 · LXL04_035436 · OH-1004

Extracellular0.014

Rank 5 · LXL04_035436 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10276.15zf-CHCC95-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035436	`PF10276.15`	zf-CHCC	95	132	1.9e-14	54.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9M6`	Arabidopsis thaliana	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial	67.273%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card