LXL04_035349 | RubberDandelionOmics

Gene overview

LXL04_035349

Reference: OH-1004 Chr: Chr08 Coordinates: 20850747-20851460 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · LXL04_035349|LXL04_035349|OH1004|cDNA

ATGATGCAGACAGAAGCATTTCCGACGACGTATCTAGGCGAACGTCCGGCGTTTTGCCGGAGCATCAGTTTCAGCAGCCTCGTGCCATGTTTATCAGAAAATTGGGGTGATTTACCGTTGAAGGTGGATGACTCAGAGGATATGGTGATTTACGGCATCTTACGTGACGCCGTTAGTGCTGGGTGGACGCCGTTTAGTTTTACGGCTAAAGAGATAAAAACCGAGTCGATGGAAGTAACGGAGCAGGCTTCGAGTACGGA...

CDS

Download CDS FASTA

714 bp · LXL04_035349|LXL04_035349|OH1004|CDS

ATGATGCAGACAGAAGCATTTCCGACGACGTATCTAGGCGAACGTCCGGCGTTTTGCCGGAGCATCAGTTTCAGCAGCCTCGTGCCATGTTTATCAGAAAATTGGGGTGATTTACCGTTGAAGGTGGATGACTCAGAGGATATGGTGATTTACGGCATCTTACGTGACGCCGTTAGTGCTGGGTGGACGCCGTTTAGTTTTACGGCTAAAGAGATAAAAACCGAGTCGATGGAAGTAACGGAGCAGGCTTCGAGTACGGA...

Protein

Download Protein FASTA

237 aa · LXL04_035349|LXL04_035349|OH1004|PROTEIN

MMQTEAFPTTYLGERPAFCRSISFSSLVPCLSENWGDLPLKVDDSEDMVIYGILRDAVSAGWTPFSFTAKEIKTESMEVTEQASSTDQSSEVTAPVEETAATSVSTVQSPVKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDRAAYRMRGSKALLNFPDRIGLNEPEPVRVTSKRRSPEPSTLLSSASESGAGSSKKRNNKVSAALLVEPEVQSRSSNELKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035349`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035349

Location Chr08:20850747-20851460 (+)

Description Similar to ERF2: Ethylene-responsive transcription factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17500`	Acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035349 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009624 response to nematode Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G17500

nsy:104217398

nta:107769743

nta:107825044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_035349 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_035349 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_035349 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_035349 · OH-1004

Plastid0.018

Rank 5 · LXL04_035349 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP2115-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035349	`PF00847.27`	AP2	115	166	7.5e-15	55.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80337`	Arabidopsis thaliana	Ethylene-responsive transcription factor 1A	57.955%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card