LXL04_035251 | RubberDandelionOmics

Gene overview

LXL04_035251

Reference: OH-1004 Chr: Chr08 Coordinates: 18524367-18525008 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · LXL04_035251|LXL04_035251|OH1004|cDNA

ATGACGATGAGCATTTCCGATCATGAAGTCCCCTACAACACCCACGACTACTACGACGTCACATTCTTCGACGACTCCATTTTAACCCTAGTCACTCGCACACCAGCCTTCGTCGACTTGTGGATCTCCGAAATCGAACGCATCCACCACCGCCGTCTCCACTTCCTCGTCGTCGGCCTTGATGTGGAGTGGCGTCCTAACTTCAGTCGCAACTACGACAACCCTGTGGCCACCCTCCAACTCTGCGTGGGACGCCGCTG...

CDS

Download CDS FASTA

642 bp · LXL04_035251|LXL04_035251|OH1004|CDS

ATGACGATGAGCATTTCCGATCATGAAGTCCCCTACAACACCCACGACTACTACGACGTCACATTCTTCGACGACTCCATTTTAACCCTAGTCACTCGCACACCAGCCTTCGTCGACTTGTGGATCTCCGAAATCGAACGCATCCACCACCGCCGTCTCCACTTCCTCGTCGTCGGCCTTGATGTGGAGTGGCGTCCTAACTTCAGTCGCAACTACGACAACCCTGTGGCCACCCTCCAACTCTGCGTGGGACGCCGCTG...

Protein

Download Protein FASTA

213 aa · LXL04_035251|LXL04_035251|OH1004|PROTEIN

MTMSISDHEVPYNTHDYYDVTFFDDSILTLVTRTPAFVDLWISEIERIHHRRLHFLVVGLDVEWRPNFSRNYDNPVATLQLCVGRRCLIYQILRSPAIPLSLRNFLRNPSYTFTGVGIADDVEKLEADYNLEVSNTADIRYMAADEFGQGELRNAGLKGLSRRVLGKELHKPKAVTMSTWDDQWLNPAQVQYACIDAFLSFEIGRILISGDFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035251`
TK1151 ID	TkA03G382400
OH-1004 ID	LXL04_035251
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	47.600
Protein coverage (%)	TK1151 97.196 / OH-1004 94.366 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035251

Location Chr08:18524367-18525008 (+)

Description Similar to WEX: Werner Syndrome-like exonuclease

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13870`	Exonuclease that digests recessed strands of DNA duplexes in the 3' to 5' direction but hardly single-stranded DNA or blunt-ended duplexes.	Biochemical characterization of an exonuclease from Arabidopsis thaliana reveals similarities to the DNA exonuclease of the human Werner syndrome protein.2003 · DOI: 10.1074/jbc.m303891200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035251 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0006139 nucleobase-containing compound metabolic process Biological Process

GO:0006259 DNA metabolic process Biological Process

GO:0006260 DNA replication Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0008340 determination of adult lifespan Biological Process

KEGG gene cross-reference

ath:AT4G13870

dme:Dmel_CG6744

hsa:7486

mmu:22427

xla:398079

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.597

Rank 1 · LXL04_035251 · OH-1004

Cytoplasm0.557

Rank 2 · LXL04_035251 · OH-1004

Cell membrane0.067

Rank 3 · LXL04_035251 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_035251 · OH-1004

Plastid0.026

Rank 5 · LXL04_035251 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01612.27DNA_pol_A_exo153-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035251	`PF01612.27`	DNA_pol_A_exo1	53	205	2.6e-13	50.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84LH3`	Arabidopsis thaliana	3'-5' exonuclease	33.553%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card