LXL04_035182 | RubberDandelionOmics

Gene overview

LXL04_035182

Reference: OH-1004 Chr: Chr08 Coordinates: 16823630-16827301 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_035182|LXL04_035182|OH1004|cDNA

ATGCCTCCTTGCTGCTTAAAAGCCCGAGCAGCTTTCTCTCCTGATGTTGAGTTTGATGCCAACTGCGATTTATATGGATGGTTTTCCGAGCATCAGAGTTCATCTGACAAACTTGGCAAAACAATGTACTTCAGCAGCCCCATGTGGCCAGGAGAAGCACATTCGCTGGAAGTACAAAGGATTTTGTTTAAAGAAAAGTCAGAGTACCAAGAAGTCTTAGTTTTTGAGTCTTTAACATATGGAAAAGTGCTTGTTCTTGA...

CDS

Download CDS FASTA

1233 bp · LXL04_035182|LXL04_035182|OH1004|CDS

ATGCCTCCTTGCTGCTTAAAAGCCCGAGCAGCTTTCTCTCCTGATGTTGAGTTTGATGCCAACTGCGATTTATATGGATGGTTTTCCGAGCATCAGAGTTCATCTGACAAACTTGGCAAAACAATGTACTTCAGCAGCCCCATGTGGCCAGGAGAAGCACATTCGCTGGAAGTACAAAGGATTTTGTTTAAAGAAAAGTCAGAGTACCAAGAAGTCTTAGTTTTTGAGTCTTTAACATATGGAAAAGTGCTTGTTCTTGA...

Protein

Download Protein FASTA

410 aa · LXL04_035182|LXL04_035182|OH1004|PROTEIN

MPPCCLKARAAFSPDVEFDANCDLYGWFSEHQSSSDKLGKTMYFSSPMWPGEAHSLEVQRILFKEKSEYQEVLVFESLTYGKVLVLDGILQLTERDEFAYQEMIAHLPLCSIKSPKNVLVVGGGDGGVLREVARHNSVEVIDICEIDKMVIDVSKKFFPDLAVGFEDPRVHLHVGDAFEFIQHVPKGKYDAIIVDSSDPVEVAEAEDSMKEAEDYLESAMESAMEEFRRFEEEMEAESNKELQGLLSIGESARGLGKSME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035182`
TK1151 ID	TkA04G157660
OH-1004 ID	LXL04_035182
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 53.140 / OH-1004 26.829 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035182

Location Chr08:16823630-16827301 (+)

Description Similar to SPMS: Spermine synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53120`	Spermine synthase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035182 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006596 polyamine biosynthetic process Biological Process

GO:0006597 spermine biosynthetic process Biological Process

GO:0008295 spermidine biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004766 spermidine synthase activity Molecular Function

GO:0016768 spermine synthase activity Molecular Function

KEGG gene cross-reference

ath:AT5G53120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · LXL04_035182 · OH-1004

Nucleus0.177

Rank 2 · LXL04_035182 · OH-1004

Mitochondrion0.174

Rank 3 · LXL04_035182 · OH-1004

Peroxisome0.171

Rank 4 · LXL04_035182 · OH-1004

Plastid0.132

Rank 5 · LXL04_035182 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17284.8Spermine_synt_N50-94 aa

PF01564.24Spermine_synth97-205 aa

PF01564.24Spermine_synth300-385 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035182	`PF17284.8`	Spermine_synt_N	50	94	2.5e-18	66.4
LXL04_035182	`PF01564.24`	Spermine_synth	97	205	1.7e-68	230.6
LXL04_035182	`PF01564.24`	Spermine_synth	300	385	1.7e-68	230.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BN2`	Arabidopsis thaliana	Spermine synthase	73.684%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card