LXL04_035154 | RubberDandelionOmics

Gene overview

LXL04_035154

Reference: OH-1004 Chr: Chr08 Coordinates: 15780957-15784086 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1563 bp · LXL04_035154|LXL04_035154|OH1004|cDNA

ATGTCTTCTCTCTCCAAATCCACCTCCTCCGTCGCTTCCCCGCCTCCGTCTGCAGACGCATTCGATGGTGCCGCGGCTGAACGCCGCCTCCGAGAGGCGGAGGATCGTTTAAGGGAGGCCATTGAGGAATTGCAACGCCGACAACGACGTGCTAAGATGCTACATCCACCTTGCGATCACGCTGACGAGTCATGTGTAGCCAACGCTATTGGTAATCTCTGCCAAAGTTTCCTTTTATCGTATGGTGTTCGTGTCGGCAT...

CDS

Download CDS FASTA

1563 bp · LXL04_035154|LXL04_035154|OH1004|CDS

ATGTCTTCTCTCTCCAAATCCACCTCCTCCGTCGCTTCCCCGCCTCCGTCTGCAGACGCATTCGATGGTGCCGCGGCTGAACGCCGCCTCCGAGAGGCGGAGGATCGTTTAAGGGAGGCCATTGAGGAATTGCAACGCCGACAACGACGTGCTAAGATGCTACATCCACCTTGCGATCACGCTGACGAGTCATGTGTAGCCAACGCTATTGGTAATCTCTGCCAAAGTTTCCTTTTATCGTATGGTGTTCGTGTCGGCAT...

Protein

Download Protein FASTA

520 aa · LXL04_035154|LXL04_035154|OH1004|PROTEIN

MSSLSKSTSSVASPPPSADAFDGAAAERRLREAEDRLREAIEELQRRQRRAKMLHPPCDHADESCVANAIGNLCQSFLLSYGVRVGIGILLRAFKLARRKSYSSLLDLKQLVSEKDLIVREEACRVGLLFGGFTGSYHALRCLLRKWRKKETPFNAILAGSVAGLSILALDDSNRRRTLALYLLARLAQCAYNSAKSKNKFHLWGSSWRHGDSLLFALSCAQVMYAFVMRPESLPKSYQDFIQKTGPVAKPVYKAVRDCC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035154`
TK1151 ID	TkA04G163030
OH-1004 ID	LXL04_035154
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035154`
Location	Chr08:15780957-15784086 (+)
Description	Similar to tmem135: Transmembrane protein 135
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035154` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006633 fatty acid biosynthetic process Biological Process GO:0007031 peroxisome organization Biological Process GO:0090140 regulation of mitochondrial fission Biological Process GO:0005739 mitochondrion Cellular Component GO:0005777 peroxisome Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0005811 lipid droplet Cellular Component GO:0031966 mitochondrial membrane Cellular Component
KEGG gene cross-reference	bta:523885 hsa:65084 xla:443967 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.735

Rank 1 · LXL04_035154 · OH-1004

Peroxisome0.126

Rank 2 · LXL04_035154 · OH-1004

Plastid0.066

Rank 3 · LXL04_035154 · OH-1004

Cytoplasm0.047

Rank 4 · LXL04_035154 · OH-1004

Nucleus0.032

Rank 5 · LXL04_035154 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466.25Tim1774-166 aa

PF15982.10TMEM135_C_rich296-424 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035154	`PF02466.25`	Tim17	74	166	7.4e-11	43.1
LXL04_035154	`PF15982.10`	TMEM135_C_rich	296	424	7.3e-07	30.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card