LXL04_035144 | RubberDandelionOmics

Gene overview

LXL04_035144

Reference: OH-1004 Chr: Chr08 Coordinates: 15571930-15575304 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2139 bp · LXL04_035144|LXL04_035144|OH1004|cDNA

ATGGATCCAAATAACCCAAGTACCCCAAGATCTTCAAACCCTCAATTCGATCCATCGAGTTTCGAACTAAATACCCAACAACGACAATTCTCCCCTCTCGATAATACTCCTCCCGGTGGTTACGTTAGTTTCTTAAACCAAGGAACGAGCTCATCCCCACTTTGTGTGGAGTATACCCATTTTAAAGTGGCCACAAAGTGGGATGACGTGGCGCAGAGTGGTCACCTCCACTTTGTGGAGTATACCCTTTTCACTTTTCA...

CDS

Download CDS FASTA

2139 bp · LXL04_035144|LXL04_035144|OH1004|CDS

ATGGATCCAAATAACCCAAGTACCCCAAGATCTTCAAACCCTCAATTCGATCCATCGAGTTTCGAACTAAATACCCAACAACGACAATTCTCCCCTCTCGATAATACTCCTCCCGGTGGTTACGTTAGTTTCTTAAACCAAGGAACGAGCTCATCCCCACTTTGTGTGGAGTATACCCATTTTAAAGTGGCCACAAAGTGGGATGACGTGGCGCAGAGTGGTCACCTCCACTTTGTGGAGTATACCCTTTTCACTTTTCA...

Protein

Download Protein FASTA

712 aa · LXL04_035144|LXL04_035144|OH1004|PROTEIN

MDPNNPSTPRSSNPQFDPSSFELNTQQRQFSPLDNTPPGGYVSFLNQGTSSSPLCVEYTHFKVATKWDDVAQSGHLHFVEYTLFTFHHRFSMKVRLLAVTIFILVNVHVTTADLSSDTEALLKFASSVPHLRKLNWSSSTPICTSWFGVKCNDDGTRVTAVHLPGVGLYGPIPSNSIGKLDALKILSLRSNFLTGNLPSDIPAIPSLQSLYLQHNNFSGYIPLPLSPQISVLDLSFNSFSGDIPVAIQNLTRLTLLNLQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035144`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035144

Location Chr08:15571930-15575304 (-)

Description Similar to At5g58300: Probable inactive receptor kinase At5g58300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58300`	Probable inactive receptor kinase At5g58300.	No verified direct reference in this release
`At3g08680`	Probable inactive receptor kinase At3g08680.	No verified direct reference in this release
`At5g05160`	Probable leucine-rich repeat receptor-like protein kinase.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At4g23740`	Probable inactive receptor kinase At4g23740.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035144 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:2000605 positive regulation of secondary growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G26730

ath:AT3G08680

ath:AT4G23740

ath:AT5G05160

ath:AT5G58300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.849

Rank 1 · LXL04_035144 · OH-1004

Cytoplasm0.083

Rank 2 · LXL04_035144 · OH-1004

Endoplasmic reticulum0.079

Rank 3 · LXL04_035144 · OH-1004

Nucleus0.065

Rank 4 · LXL04_035144 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_035144 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_2115-152 aa

PF13855.13LRR_8175-217 aa

PF12799.14LRR_4183-218 aa

PF07714.24PK_Tyr_Ser-Thr424-686 aa

PF00069.32Pkinase424-685 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035144	`PF08263.18`	LRRNT_2	115	152	5.7e-08	33.6
LXL04_035144	`PF13855.13`	LRR_8	175	217	1.9e-10	41.1
LXL04_035144	`PF12799.14`	LRR_4	183	218	1e-07	32.6
LXL04_035144	`PF07714.24`	PK_Tyr_Ser-Thr	424	686	2e-40	139.5
LXL04_035144	`PF00069.32`	Pkinase	424	685	5.7e-35	121.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVM0`	Arabidopsis thaliana	Probable inactive receptor kinase At5g58300	56.703%	Swiss-Prot	strong database homology
`Q9C9Y8`	Arabidopsis thaliana	Probable inactive receptor kinase At3g08680	56.487%	Swiss-Prot	strong database homology
`Q9FHK7`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g05160	54.711%	Swiss-Prot	strong database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	51.196%	Swiss-Prot	strong database homology
`Q9SUQ3`	Arabidopsis thaliana	Probable inactive receptor kinase At4g23740	44.444%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card