LXL04_035119 | RubberDandelionOmics

Gene overview

LXL04_035119

Reference: OH-1004 Chr: Chr08 Coordinates: 14920743-14924385 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1479 bp · LXL04_035119|LXL04_035119|OH1004|cDNA

ATGGACCGAACCCTACAATCACCGAATGTTGCAGACAATTGTACGCCGATTTCAGAGATGAATCCTAGGGTTGAGATTGATACATCGCCGCCGTTTGGGTCGGTGAAGGAGGCGGTGACTCGGTTCGGTGGAAGTGGTTCGTGGGTTCCCCTTAATGTCCTTCGACTCGCCGGGCAAGACCCAGAAGAAATGGATATGGATACCGTCGAGAAACAAGCCGCCGAACTCGAAAAAGAACTAATTACTAAGGAACAAGAAAC...

CDS

Download CDS FASTA

1479 bp · LXL04_035119|LXL04_035119|OH1004|CDS

ATGGACCGAACCCTACAATCACCGAATGTTGCAGACAATTGTACGCCGATTTCAGAGATGAATCCTAGGGTTGAGATTGATACATCGCCGCCGTTTGGGTCGGTGAAGGAGGCGGTGACTCGGTTCGGTGGAAGTGGTTCGTGGGTTCCCCTTAATGTCCTTCGACTCGCCGGGCAAGACCCAGAAGAAATGGATATGGATACCGTCGAGAAACAAGCCGCCGAACTCGAAAAAGAACTAATTACTAAGGAACAAGAAAC...

Protein

Download Protein FASTA

492 aa · LXL04_035119|LXL04_035119|OH1004|PROTEIN

MDRTLQSPNVADNCTPISEMNPRVEIDTSPPFGSVKEAVTRFGGSGSWVPLNVLRLAGQDPEEMDMDTVEKQAAELEKELITKEQETLEVLRELEFAKGVMEGLKLNLNKETSSIITSLNLNPDSRPTTPVDQSTPTLTLCPVPLPPGIILTELKEAKSNLNKTTKDLTMIRASVESLNKKLRTHKSNLAEKDGEMKRVIEESVDTTNGFCKLTFEGQQFRRMEEAAQYEVIKATSEIENTKLSIKMVEMRLIAAKKMEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035119`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035119

Location Chr08:14920743-14924385 (+)

Description Similar to At2g40480: WEB family protein At2g40480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40480`	WEB family protein At2g40480.	No verified direct reference in this release
`At2g38370`	WEB family protein At2g38370.	No verified direct reference in this release
`At3g51720`	WEB family protein At3g51720.	No verified direct reference in this release
`At3g56270`	WEB family protein At3g56270.	No verified direct reference in this release
`At4g33390`	Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035119 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009903 chloroplast avoidance movement Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G38370

ath:AT2G40480

ath:AT3G51720

ath:AT3G56270

ath:AT4G33390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.396

Rank 1 · LXL04_035119 · OH-1004

Cell membrane0.371

Rank 2 · LXL04_035119 · OH-1004

Nucleus0.339

Rank 3 · LXL04_035119 · OH-1004

Plastid0.064

Rank 4 · LXL04_035119 · OH-1004

Endoplasmic reticulum0.053

Rank 5 · LXL04_035119 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05701.17WEMBL24-110 aa

PF05701.17WEMBL152-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035119	`PF05701.17`	WEMBL	24	110	3.4e-25	89.5
LXL04_035119	`PF05701.17`	WEMBL	152	305	3.4e-25	89.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XVC7`	Arabidopsis thaliana	WEB family protein At2g40480	31.923%	Swiss-Prot	moderate database homology
`F4ISY0`	Arabidopsis thaliana	WEB family protein At2g38370	32.432%	Swiss-Prot	moderate database homology
`Q9SCT6`	Arabidopsis thaliana	WEB family protein At3g51720	33.917%	Swiss-Prot	moderate database homology
`Q9LYL6`	Arabidopsis thaliana	WEB family protein At3g56270	26.829%	Swiss-Prot	weak database homology
`Q9SZB6`	Arabidopsis thaliana	Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 1	35.965%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card