LXL04_035037 | RubberDandelionOmics

Gene overview

LXL04_035037

Reference: OH-1004 Chr: Chr08 Coordinates: 11667842-11670457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · LXL04_035037|LXL04_035037|OH1004|cDNA

ATGGCGTCTCCATCTCAAGCAAGTCTCCTTCTGCAGAAACAGTTGAAAGATCTCTGTAAAAACCCCGTTGATGGATTCTCGGCTGGTCTTGTTGATGAAAGCAATCTATTTGAATGGAGTGTCACAATTATCGGGCCGCCCGATACATTATATGATGGTGGTTTCTTCAATGCTATAATGACATTTCCACAAAATTATCCAAACAGCCCTCCAACTGTGAGATTTACATCAGATGTTTGGCATCCTAATGTTTACCCTGA...

CDS

Download CDS FASTA

774 bp · LXL04_035037|LXL04_035037|OH1004|CDS

ATGGCGTCTCCATCTCAAGCAAGTCTCCTTCTGCAGAAACAGTTGAAAGATCTCTGTAAAAACCCCGTTGATGGATTCTCGGCTGGTCTTGTTGATGAAAGCAATCTATTTGAATGGAGTGTCACAATTATCGGGCCGCCCGATACATTATATGATGGTGGTTTCTTCAATGCTATAATGACATTTCCACAAAATTATCCAAACAGCCCTCCAACTGTGAGATTTACATCAGATGTTTGGCATCCTAATGTTTACCCTGA...

Protein

Download Protein FASTA

257 aa · LXL04_035037|LXL04_035037|OH1004|PROTEIN

MASPSQASLLLQKQLKDLCKNPVDGFSAGLVDESNLFEWSVTIIGPPDTLYDGGFFNAIMTFPQNYPNSPPTVRFTSDVWHPNVYPDGKVCISILHPPGDDPNGYELASERWTPVHTVESIMLSIISMLSSPNDESPANVEAAKEWRDRRDDFRKKVGRCVRKSQELIPQIIKHLLEVFLVQTWTQVFKPFSTFLEQKKKKRRPKHTTKKPLHSIVHLLLSLNSTLTQLLHLHDSHILLRRLLVLFRRQRRLLVAAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035037`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035037

Location Chr08:11667842-11670457 (-)

Description Similar to UBC7: Ubiquitin-conjugating enzyme E2 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59300`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At3g46460`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At3g55380`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035037 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT3G46460

ath:AT3G55380

ath:AT5G59300

rno:64631

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.559

Rank 1 · LXL04_035037 · OH-1004

Cytoplasm0.483

Rank 2 · LXL04_035037 · OH-1004

Mitochondrion0.079

Rank 3 · LXL04_035037 · OH-1004

Endoplasmic reticulum0.069

Rank 4 · LXL04_035037 · OH-1004

Cell membrane0.055

Rank 5 · LXL04_035037 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179.32UQ_con11-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035037	`PF00179.32`	UQ_con	11	160	2.9e-50	170.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42540`	Arabidopsis thaliana	Ubiquitin-conjugating enzyme E2 7	90.854%	Swiss-Prot	moderate database homology
`Q42541`	Arabidopsis thaliana	Ubiquitin-conjugating enzyme E2 13	89.024%	Swiss-Prot	moderate database homology
`P42747`	Arabidopsis thaliana	Ubiquitin-conjugating enzyme E2 14	84.756%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card