LXL04_034810 | RubberDandelionOmics

Gene overview

LXL04_034810

Reference: OH-1004 Chr: Chr08 Coordinates: 2116659-2118231 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1440 bp · LXL04_034810|LXL04_034810|OH1004|cDNA

ATGAAACCATCCAACTCTACTATAGTATTTCTTGCATATTGTTTTCTATTGGTTGGGATAGTTGCAGGAAAAAGAAGTGCTTTGGATACAAGTGCAGGCGACGCAGAAACCATTGCCCACCACTATCAAACAGTCAAACTAAGCTCTTTCCTATCATCTTCAATATGTAGTCCTTCAAGTAAACGTGACAAGAAAAGCATATCATTTGAAGTGGTTCACAAACTTGGACCATGTTCCAAGTTCAgtaaaaagaaattaaa...

CDS

Download CDS FASTA

1440 bp · LXL04_034810|LXL04_034810|OH1004|CDS

ATGAAACCATCCAACTCTACTATAGTATTTCTTGCATATTGTTTTCTATTGGTTGGGATAGTTGCAGGAAAAAGAAGTGCTTTGGATACAAGTGCAGGCGACGCAGAAACCATTGCCCACCACTATCAAACAGTCAAACTAAGCTCTTTCCTATCATCTTCAATATGTAGTCCTTCAAGTAAACGTGACAAGAAAAGCATATCATTTGAAGTGGTTCACAAACTTGGACCATGTTCCAAGTTCAGTAAAAAGAAATTAAA...

Protein

Download Protein FASTA

479 aa · LXL04_034810|LXL04_034810|OH1004|PROTEIN

MKPSNSTIVFLAYCFLLVGIVAGKRSALDTSAGDAETIAHHYQTVKLSSFLSSSICSPSSKRDKKSISFEVVHKLGPCSKFSKKKLKAITLEEILTRDQSRVDTIRSRLTTTSTTRKKVINFKSSKATMPVKSGTTYDSGNYIVNVEIGTPKKNEQLILDSGSDLTWTQCQPCTGSCYTQQEPIFNPSLSTTYSNIPCTSTACSMIPSATGNLPGCSSSTCVYGVQYGDGSYSVGKLAKDKLTLTNNETLDNFYFGCGVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034810`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034810

Location Chr08:2116659-2118231 (-)

Description Similar to At5g10770: Aspartyl protease family protein At5g10770

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10770`	Probably not redundant with AED1 and not involved in restriction of salicylic acid (SA) or systemic acquired resistance (SAR) signaling.	No verified direct reference in this release
`At5g10760`	Aspartyl protease involved in a homeostatic feedback mechanism regulating systemic immunity.	Contrasting Roles of the Apoplastic Aspartyl Protease APOPLASTIC, ENHANCED DISEASE SUSCEPTIBILITY1-DEPENDENT1 and LEGUME LECTIN-LIKE PROTEIN1 in Arabidopsis Systemic Acquired Resistance.2014 · DOI: 10.1104/pp.114.239665
`At1g01300`	Aspartyl protease.	No verified direct reference in this release
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433
`At3g20015`	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034810 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT3G18490

ath:AT3G20015

ath:AT5G10760

ath:AT5G10770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.642

Rank 1 · LXL04_034810 · OH-1004

Cell membrane0.132

Rank 2 · LXL04_034810 · OH-1004

Endoplasmic reticulum0.126

Rank 3 · LXL04_034810 · OH-1004

Cytoplasm0.086

Rank 4 · LXL04_034810 · OH-1004

Lysosome / Vacuole0.056

Rank 5 · LXL04_034810 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026.29Asp141-195 aa

PF14543.12TAXi_N142-310 aa

PF00026.29Asp224-473 aa

PF14541.12TAXi_C333-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034810	`PF00026.29`	Asp	141	195	5.8e-26	92.4
LXL04_034810	`PF14543.12`	TAXi_N	142	310	4.1e-52	177.6
LXL04_034810	`PF00026.29`	Asp	224	473	5.8e-26	92.4
LXL04_034810	`PF14541.12`	TAXi_C	333	473	2.6e-24	86.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S9J6`	Arabidopsis thaliana	Aspartyl protease family protein At5g10770	49.043%	Swiss-Prot	moderate database homology
`Q9LEW3`	Arabidopsis thaliana	Aspartyl protease AED1	43.405%	Swiss-Prot	moderate database homology
`Q9LNJ3`	Arabidopsis thaliana	Aspartyl protease family protein 2	37.500%	Swiss-Prot	moderate database homology
`Q9LS40`	Arabidopsis thaliana	Protein ASPARTIC PROTEASE IN GUARD CELL 1	36.691%	Swiss-Prot	moderate database homology
`Q9LHE3`	Arabidopsis thaliana	Protein ASPARTIC PROTEASE IN GUARD CELL 2	35.750%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card