LXL04_034741 | RubberDandelionOmics

Gene overview

LXL04_034741

Reference: OH-1004 Chr: Chr07 Coordinates: 115393059-115395710 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1404 bp · LXL04_034741|LXL04_034741|OH1004|cDNA

ATGTCGGAGAAATTCTCGGCTACACTAAGGATCGGCGACCTTAATGATTTCATCGCGCCGTCACAGGGATGTGTCGTTTCTATGAAGTCCGGTTCCGCTAGGCTCGTTGATAAACCAAAGAAGGTGGCAAAAACAATACCTGTTAAAGAAACTCTTCAAACAGATCCAGTAAAAATATCACTCAAGGATTGCTTAGCATGCAGTGGATGCATTACTTCAGCAGAGACAGTTATGTTAGAGAAGCAAAGCTTGGATGAGTT...

CDS

Download CDS FASTA

1404 bp · LXL04_034741|LXL04_034741|OH1004|CDS

ATGTCGGAGAAATTCTCGGCTACACTAAGGATCGGCGACCTTAATGATTTCATCGCGCCGTCACAGGGATGTGTCGTTTCTATGAAGTCCGGTTCCGCTAGGCTCGTTGATAAACCAAAGAAGGTGGCAAAAACAATACCTGTTAAAGAAACTCTTCAAACAGATCCAGTAAAAATATCACTCAAGGATTGCTTAGCATGCAGTGGATGCATTACTTCAGCAGAGACAGTTATGTTAGAGAAGCAAAGCTTGGATGAGTT...

Protein

Download Protein FASTA

467 aa · LXL04_034741|LXL04_034741|OH1004|PROTEIN

MSEKFSATLRIGDLNDFIAPSQGCVVSMKSGSARLVDKPKKVAKTIPVKETLQTDPVKISLKDCLACSGCITSAETVMLEKQSLDEFLSNINNGKTVIVSLSPQSRASIAVHFGLSPLQVFRKLTTLFKSLGVKAVFDTSCSRDLSLIESCNEFISRYKQSNSESTSYLPMISSACPGWICYAEKTLGSYVLPYISTVKSPQQSIGAIIKHHLCQKLGIRAGEIYHVTVMPCYDKKLEASRDDFVFQNDQSMTTEVDSVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034741`
TK1151 ID	TkA08G431650
OH-1004 ID	LXL04_034741
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034741

Location Chr07:115393059-115395710 (-)

Description Similar to NAR1: Protein NAR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16440`	Essential component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery.	The DUF59 family gene AE7 acts in the cytosolic iron-sulfur cluster assembly pathway to maintain nuclear genome integrity in Arabidopsis.2012 · DOI: 10.1105/tpc.112.102608 The role of Arabidopsis thaliana NAR1, a cytosolic iron-sulfur cluster assembly component, in gametophytic gene expression and oxidative stress responses in vegetative tissue.2013 · DOI: 10.1111/nph.12350

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034741 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0032364 intracellular oxygen homeostasis Biological Process

GO:0070482 response to oxygen levels Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0097361 cytosolic [4Fe-4S] assembly targeting complex Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G16440

bta:511837

hsa:64428

mmu:67563

rno:360496

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.719

Rank 1 · LXL04_034741 · OH-1004

Nucleus0.313

Rank 2 · LXL04_034741 · OH-1004

Mitochondrion0.100

Rank 3 · LXL04_034741 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_034741 · OH-1004

Peroxisome0.053

Rank 5 · LXL04_034741 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02906.20Fe_hyd_lg_C95-392 aa

PF02256.23Fe_hyd_SSU421-455 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034741	`PF02906.20`	Fe_hyd_lg_C	95	392	3.3e-84	283.4
LXL04_034741	`PF02256.23`	Fe_hyd_SSU	421	455	3.5e-12	46.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CL6`	Arabidopsis thaliana	Protein NAR1	71.279%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card