LXL04_034731 | RubberDandelionOmics

Gene overview

LXL04_034731

Reference: OH-1004 Chr: Chr07 Coordinates: 115200751-115201161 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · LXL04_034731|LXL04_034731|OH1004|cDNA

ATGCAAAGCTTAAGAGATTCTATACTCAGGCATGTTAGGGTTACACGACAGTTAATCTCAACAAAACGGCAGCTTTGCACATCCACCCATGACCAGGTATCCGCTCGAGTTATTGGGTTGGTAAAGAAATTCGACAAAATCGACGCCTCTAAGGTTAATGAATTAGCTGATTTCCAGAAAGATTTGAGTCTTGACAGCCTGGACAGGGTGGAGCTTGTCATGGCTTTTGAGCAAGAATTCTCCATTGAGATCCCTGATGA...

CDS

Download CDS FASTA

336 bp · LXL04_034731|LXL04_034731|OH1004|CDS

ATGCAAAGCTTAAGAGATTCTATACTCAGGCATGTTAGGGTTACACGACAGTTAATCTCAACAAAACGGCAGCTTTGCACATCCACCCATGACCAGGTATCCGCTCGAGTTATTGGGTTGGTAAAGAAATTCGACAAAATCGACGCCTCTAAGGTTAATGAATTAGCTGATTTCCAGAAAGATTTGAGTCTTGACAGCCTGGACAGGGTGGAGCTTGTCATGGCTTTTGAGCAAGAATTCTCCATTGAGATCCCTGATGA...

Protein

Download Protein FASTA

111 aa · LXL04_034731|LXL04_034731|OH1004|PROTEIN

MQSLRDSILRHVRVTRQLISTKRQLCTSTHDQVSARVIGLVKKFDKIDASKVNELADFQKDLSLDSLDRVELVMAFEQEFSIEIPDEQADKLKCCADVAQYIISAPKQEDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034731`
TK1151 ID	TkA08G430980
OH-1004 ID	LXL04_034731
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034731

Location Chr07:115200751-115201161 (-)

Description Similar to MTACP2: Acyl carrier protein 3, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47630`	Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity).	No verified direct reference in this release
`At2g44620`	Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity).	No verified direct reference in this release
`At1g65290`	Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009107 lipoate biosynthetic process Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

KEGG gene cross-reference

ath:AT1G65290

ath:AT2G44620

ath:AT5G47630

ddi:DDB_G0291866

sce:YKL192C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.928

Rank 1 · LXL04_034731 · OH-1004

Cytoplasm0.060

Rank 2 · LXL04_034731 · OH-1004

Nucleus0.051

Rank 3 · LXL04_034731 · OH-1004

Plastid0.015

Rank 4 · LXL04_034731 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_034731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00550.32PP-binding36-102 aa

PF14573.12PP-binding_239-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034731	`PF00550.32`	PP-binding	36	102	7.6e-10	39.6
LXL04_034731	`PF14573.12`	PP-binding_2	39	107	4.4e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGJ4`	Arabidopsis thaliana	Acyl carrier protein 3, mitochondrial	53.279%	Swiss-Prot	strong database homology
`P53665`	Arabidopsis thaliana	Acyl carrier protein 1, mitochondrial	44.068%	Swiss-Prot	moderate database homology
`O80800`	Arabidopsis thaliana	Acyl carrier protein 2, mitochondrial	51.316%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card