LXL04_034711 | RubberDandelionOmics

Gene overview

LXL04_034711

Reference: OH-1004 Chr: Chr07 Coordinates: 114561293-114565905 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · LXL04_034711|LXL04_034711|OH1004|cDNA

ATGTCATCAAATCATAAGAGTTTTGTAGGTGAAAAACCCTCAAGAAATCTTTCAAACAAAACATGGGCAGTGTTCCTTTGGATTTTCAGCTTCTGCGCTGGAATGTTGTTTACCAACAGGATGTGGATTGATCCGGAAGGTAGCGAAATTGTAAGGCTAATACAGAAGAACTGGGGTGGTTACAAATTTAAATATGAGATTACCGGCACTAGATCCAATACTACACGGGATGTTTATGAGATTTATCATTCTATCAAAAA...

CDS

Download CDS FASTA

1185 bp · LXL04_034711|LXL04_034711|OH1004|CDS

ATGTCATCAAATCATAAGAGTTTTGTAGGTGAAAAACCCTCAAGAAATCTTTCAAACAAAACATGGGCAGTGTTCCTTTGGATTTTCAGCTTCTGCGCTGGAATGTTGTTTACCAACAGGATGTGGATTGATCCGGAAGGTAGCGAAATTGTAAGGCTAATACAGAAGAACTGGGGTGGTTACAAATTTAAATATGAGATTACCGGCACTAGATCCAATACTACACGGGATGTTTATGAGATTTATCATTCTATCAAAAA...

Protein

Download Protein FASTA

394 aa · LXL04_034711|LXL04_034711|OH1004|PROTEIN

MSSNHKSFVGEKPSRNLSNKTWAVFLWIFSFCAGMLFTNRMWIDPEGSEIVRLIQKNWGGYKFKYEITGTRSNTTRDVYEIYHSIKKLEKKIVNLKTKLDDFTTRNQSTPKDYSLDTRDLNTKRKYFIVIGINSGFSSRKRRDSIRATWMPQGEKRKRLEEEIGIVTCFIIGNSTRTDGVLDNSIEEEEKLYGDFMRLNHSEPYMDLSAKTKMYFATAVKTWDADFYVKVDDDVHVNIGALTRKLLGHVNKPRVYIGCMN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034711`
TK1151 ID	TkA08G428530
OH-1004 ID	LXL04_034711
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034711

Location Chr07:114561293-114565905 (+)

Description Similar to B3GALT2: Probable beta-1,3-galactosyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05170`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g11730`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At4g26940`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At2g32430`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g32930`	Beta-galactosyltransferase involved in elongation of beta-1,6-linked galactan side chains on arabinogalactan proteins.	A galactosyltransferase acting on arabinogalactan protein glycans is essential for embryo development in Arabidopsis.2013 · DOI: 10.1111/tpj.12281 Galactosyltransferases from Arabidopsis thaliana in the biosynthesis of type II arabinogalactan: molecular interaction enhances enzyme activity.2014 · DOI: 10.1186/1471-2229-14-90

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034711 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05170

ath:AT1G11730

ath:AT1G32930

ath:AT2G32430

ath:AT4G26940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.801

Rank 1 · LXL04_034711 · OH-1004

Endoplasmic reticulum0.082

Rank 2 · LXL04_034711 · OH-1004

Cell membrane0.078

Rank 3 · LXL04_034711 · OH-1004

Cytoplasm0.064

Rank 4 · LXL04_034711 · OH-1004

Extracellular0.048

Rank 5 · LXL04_034711 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13334.12DUF409420-99 aa

PF01762.28Galactosyl_T140-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034711	`PF13334.12`	DUF4094	20	99	1.4e-12	48.6
LXL04_034711	`PF01762.28`	Galactosyl_T	140	337	3.9e-50	171.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A8MRC7`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 2	51.637%	Swiss-Prot	strong database homology
`Q9SAA4`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 1	54.233%	Swiss-Prot	strong database homology
`Q8LEJ9`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 4	52.577%	Swiss-Prot	strong database homology
`Q9ZV71`	Arabidopsis thaliana	Probable beta-1,3-galactosyltransferase 3	52.020%	Swiss-Prot	strong database homology
`Q9MAP8`	Arabidopsis thaliana	Beta-1,6-galactosyltransferase GALT31A	47.837%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card