LXL04_034453 | RubberDandelionOmics

Gene overview

LXL04_034453

Reference: OH-1004 Chr: Chr07 Coordinates: 101124695-101125266 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · LXL04_034453|LXL04_034453|OH1004|cDNA

ATGGGACTCCTCAGCATCATTCGGAAGATCAAAcggaaagaaaaagaaatgcgCATTCTTATGGTGGGACTTGACAATTCTGGGAAGACAACAATAGTGTTGAAAATCAATGGTGAATATACCAGTGTCATCAGCCCTACTCTTGGCTTCAACATCAAAACCATGACCTATGATAAGTATACCCTAAACATATGGGATGTTGGAGGTCAAAAGACTATACGGTCTTACTGGAGAAACTACTTTGAGCAAACAGATGGATT...

CDS

Download CDS FASTA

372 bp · LXL04_034453|LXL04_034453|OH1004|CDS

ATGGGACTCCTCAGCATCATTCGGAAGATCAAACGGAAAGAAAAAGAAATGCGCATTCTTATGGTGGGACTTGACAATTCTGGGAAGACAACAATAGTGTTGAAAATCAATGGTGAATATACCAGTGTCATCAGCCCTACTCTTGGCTTCAACATCAAAACCATGACCTATGATAAGTATACCCTAAACATATGGGATGTTGGAGGTCAAAAGACTATACGGTCTTACTGGAGAAACTACTTTGAGCAAACAGATGGATT...

Protein

Download Protein FASTA

123 aa · LXL04_034453|LXL04_034453|OH1004|PROTEIN

MGLLSIIRKIKRKEKEMRILMVGLDNSGKTTIVLKINGEYTSVISPTLGFNIKTMTYDKYTLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLIRLDDCKYELDNLLKEEVTFIISLLIA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034453`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034453

Location Chr07:101124695-101125266 (-)

Description Similar to ARL2: ADP-ribosylation factor-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18390`	Has a role in the cofactor-dependent pathway of microtubule biogenesis.	The TITAN5 gene of Arabidopsis encodes a protein related to the ADP ribosylation factor family of GTP binding proteins.2000 · DOI: 10.1105/tpc.12.8.1379

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034453 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000132 establishment of mitotic spindle orientation Biological Process

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006457 protein folding Biological Process

GO:0007021 tubulin complex assembly Biological Process

GO:0007098 centrosome cycle Biological Process

GO:0009558 embryo sac cellularization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009960 endosperm development Biological Process

GO:0010811 positive regulation of cell-substrate adhesion Biological Process

GO:0015870 acetylcholine transport Biological Process

GO:0031113 regulation of microtubule polymerization Biological Process

KEGG gene cross-reference

ath:AT2G18390

bta:511349

dme:Dmel_CG7435

hsa:402

mmu:56327

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393

Rank 1 · LXL04_034453 · OH-1004

Golgi apparatus0.280

Rank 2 · LXL04_034453 · OH-1004

Lysosome / Vacuole0.222

Rank 3 · LXL04_034453 · OH-1004

Endoplasmic reticulum0.174

Rank 4 · LXL04_034453 · OH-1004

Cell membrane0.157

Rank 5 · LXL04_034453 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf4-122 aa

PF09439.17SRPRB15-94 aa

PF08477.20Roc18-117 aa

PF00071.29Ras18-106 aa

PF04670.19Gtr1_RagA18-95 aa

PF01926.30MMR_HSR118-112 aa

PF00503.27G-alpha45-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034453	`PF00025.28`	Arf	4	122	1.9e-45	155.2
LXL04_034453	`PF09439.17`	SRPRB	15	94	7.8e-06	26.1
LXL04_034453	`PF08477.20`	Roc	18	117	8.2e-12	46.1
LXL04_034453	`PF00071.29`	Ras	18	106	3.8e-08	33.8
LXL04_034453	`PF04670.19`	Gtr1_RagA	18	95	1.7e-06	28.4
LXL04_034453	`PF01926.30`	MMR_HSR1	18	112	6.4e-06	27.0
LXL04_034453	`PF00503.27`	G-alpha	45	95	1.7e-11	44.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPX1`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 2	90.164%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card