LXL04_034256 | RubberDandelionOmics

Gene overview

LXL04_034256

Reference: OH-1004 Chr: Chr07 Coordinates: 93418452-93424932 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1881 bp · LXL04_034256|LXL04_034256|OH1004|cDNA

ATGGCTGGATTAAGAAGATCAAGCGAGATGAAGGACAGGAGAAGCATCCGATCTGTTAATGGTCGTACGATTCCTGTGAGAGGTCAAGTGAAGGTAGCAATCGTTTCAGGATTAGCTCAGTCTCTCGCATCACTCTTCTCCTTTAATGGTCGCTCATGTTCTTCTTTCCAATGTTTGAGTTATTTGAACTGGTACGAGAGTTATAAGGTGGCGTTTGGTTGGCACAATGTTGCGGAtggaaaagaaaatgaattgaAAAA...

CDS

Download CDS FASTA

1881 bp · LXL04_034256|LXL04_034256|OH1004|CDS

ATGGCTGGATTAAGAAGATCAAGCGAGATGAAGGACAGGAGAAGCATCCGATCTGTTAATGGTCGTACGATTCCTGTGAGAGGTCAAGTGAAGGTAGCAATCGTTTCAGGATTAGCTCAGTCTCTCGCATCACTCTTCTCCTTTAATGGTCGCTCATGTTCTTCTTTCCAATGTTTGAGTTATTTGAACTGGTACGAGAGTTATAAGGTGGCGTTTGGTTGGCACAATGTTGCGGATGGAAAAGAAAATGAATTGAAAAA...

Protein

Download Protein FASTA

626 aa · LXL04_034256|LXL04_034256|OH1004|PROTEIN

MAGLRRSSEMKDRRSIRSVNGRTIPVRGQVKVAIVSGLAQSLASLFSFNGRSCSSFQCLSYLNWYESYKVAFGWHNVADGKENELKKESGKGIQFHMLFANKAQQEVSSPDQFQQTSDLAIFSSKHQTSPSPFPSLLPRSISVNPPNLTLNWFCFFIRHHQEANPIECRVFVNRSASLRAFWKKIFAGLGVIPMVDSNLALLAKWPWRFRTESDALWVKVIQSIHGENGALDTKLEEKGTGVVGRVKIGDGVRTKFWTDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034256`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034256

Location Chr07:93418452-93424932 (-)

Description Similar to TIM50: Mitochondrial import inner membrane translocase subunit TIM50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55900`	Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034256 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0015031 protein transport Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0046902 regulation of mitochondrial membrane permeability Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0008320 protein transmembrane transporter activity Molecular Function

GO:0030943 mitochondrion targeting sequence binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G55900

cgr:2888680

cnb:CNBA4980

cne:CNA05150

sce:YPL063W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.412

Rank 1 · LXL04_034256 · OH-1004

Cytoplasm0.354

Rank 2 · LXL04_034256 · OH-1004

Cell membrane0.148

Rank 3 · LXL04_034256 · OH-1004

Endoplasmic reticulum0.077

Rank 4 · LXL04_034256 · OH-1004

Plastid0.054

Rank 5 · LXL04_034256 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966.12zf-RVT357-426 aa

PF03031.25NIF489-581 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034256	`PF13966.12`	zf-RVT	357	426	9.3e-13	49.4
LXL04_034256	`PF03031.25`	NIF	489	581	1.2e-17	64.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYE2`	Arabidopsis thaliana	Mitochondrial import inner membrane translocase subunit TIM50	70.400%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card