LXL04_034120 | RubberDandelionOmics

Gene overview

LXL04_034120

Reference: OH-1004 Chr: Chr07 Coordinates: 83082779-83089392 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3156 bp · LXL04_034120|LXL04_034120|OH1004|cDNA

ATGGGCGAACCCCGAGCTAAGCGTCCGAAAATCAGCAGGGGCGCAGATGATTACTTACCAGGAAACATAGTTGAAATTGAGATCCACAACTTCATGACTTTCAATCATCTTGTATGCAAGCCTGGTTCTCGCTTGAATCTTGTCATTGGTCCAAATGGATCCGGTAAAAGCTCTCTGGTGTGTGCAATTGCTCTTGGTTTAGGTGGTGAACCTCAGCTTTTGGGAAGGGCAGGGACTGTTGGTGCATTTGTGAAACGTGG...

CDS

Download CDS FASTA

3156 bp · LXL04_034120|LXL04_034120|OH1004|CDS

ATGGGCGAACCCCGAGCTAAGCGTCCGAAAATCAGCAGGGGCGCAGATGATTACTTACCAGGAAACATAGTTGAAATTGAGATCCACAACTTCATGACTTTCAATCATCTTGTATGCAAGCCTGGTTCTCGCTTGAATCTTGTCATTGGTCCAAATGGATCCGGTAAAAGCTCTCTGGTGTGTGCAATTGCTCTTGGTTTAGGTGGTGAACCTCAGCTTTTGGGAAGGGCAGGGACTGTTGGTGCATTTGTGAAACGTGG...

Protein

Download Protein FASTA

1051 aa · LXL04_034120|LXL04_034120|OH1004|PROTEIN

MGEPRAKRPKISRGADDYLPGNIVEIEIHNFMTFNHLVCKPGSRLNLVIGPNGSGKSSLVCAIALGLGGEPQLLGRAGTVGAFVKRGEESGYTKITLRGDTPNEKLIITRKIDSRNKSDWLFNGRTVSKKEILEVIQKFNIQVNNLTQFLPQDRVCEFAKLSPVRLLEETEKAVGDPQLPVLHRALVDTSAEVQRSEQAVEKNKETLTQLKALNAEQERDVERVRQRDELLAKAESMKKKLPWLKYDMKKAEYLEAKELE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034120`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034120

Location Chr07:83082779-83089392 (+)

Description Similar to SMC5: Structural maintenance of chromosomes protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15920`	Core component of the SMC5-SMC6 complex that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids.	The STRUCTURAL MAINTENANCE OF CHROMOSOMES 5/6 complex promotes sister chromatid alignment and homologous recombination after DNA damage in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.108.060525

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034120 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0018393 internal peptidyl-lysine acetylation Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0030261 chromosome condensation Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0034184 positive regulation of maintenance of mitotic sister chromatid cohesion Biological Process

GO:0044772 mitotic cell cycle phase transition Biological Process

KEGG gene cross-reference

ath:AT5G15920

dre:566749

hsa:23137

mmu:226026

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · LXL04_034120 · OH-1004

Cytoplasm0.186

Rank 2 · LXL04_034120 · OH-1004

Mitochondrion0.033

Rank 3 · LXL04_034120 · OH-1004

Cell membrane0.025

Rank 4 · LXL04_034120 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_034120 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02463.26SMC_N23-989 aa

PF13476.13AAA_2326-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034120	`PF02463.26`	SMC_N	23	989	6.1e-22	78.9
LXL04_034120	`PF13476.13`	AAA_23	26	274	3.3e-11	44.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFS8`	Arabidopsis thaliana	Structural maintenance of chromosomes protein 5	65.067%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card