LXL04_034107 | RubberDandelionOmics

Gene overview

LXL04_034107

Reference: OH-1004 Chr: Chr07 Coordinates: 82279820-82286062 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1794 bp · LXL04_034107|LXL04_034107|OH1004|cDNA

atgtcaaaccaaaGAACAATTCACACGGATCACCATCCCCCCATTTCACTCGGATATCCTTACCTCGCCATTCCTCCGACACCATCCTCGATCTTCACCAGCCTCGATCTTCACCAGCTCCTCTACACGCTTGCACGCTTCGATTCCATTTCAAAGGGCGCGAAATCAGCAGCGTGCACAGCCTCGAAAATGGTGGgatttccctctctatatttacccATTTCTAGGCTGTGGAAATCGATCAGAAATCAGTTGAAGCT...

CDS

Download CDS FASTA

1794 bp · LXL04_034107|LXL04_034107|OH1004|CDS

ATGTCAAACCAAAGAACAATTCACACGGATCACCATCCCCCCATTTCACTCGGATATCCTTACCTCGCCATTCCTCCGACACCATCCTCGATCTTCACCAGCCTCGATCTTCACCAGCTCCTCTACACGCTTGCACGCTTCGATTCCATTTCAAAGGGCGCGAAATCAGCAGCGTGCACAGCCTCGAAAATGGTGGGATTTCCCTCTCTATATTTACCCATTTCTAGGCTGTGGAAATCGATCAGAAATCAGTTGAAGCT...

Protein

Download Protein FASTA

597 aa · LXL04_034107|LXL04_034107|OH1004|PROTEIN

MSNQRTIHTDHHPPISLGYPYLAIPPTPSSIFTSLDLHQLLYTLARFDSISKGAKSAACTASKMVGFPSLYLPISRLWKSIRNQLKLGFVLQLDRILPFRFILLLSIHLQGYGFGLCCRSTLQREFGLCCRSTLQRFILQVYFGGKMVQLLQITPLYLQYEKHNYTDRKGTSFSGLELFEMSPVVLHSAGGTENYRNGPFGEYLIEIWKAVGMNLEGDNRSELRTGVDIVVATPRRFIDHLQQGNTSLTWISYVVIDEAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034107`
TK1151 ID	TkA08G358790
OH-1004 ID	LXL04_034107
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.900
Protein coverage (%)	TK1151 86.667 / OH-1004 23.283 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034107

Location Chr07:82279820-82286062 (-)

Description Similar to DBP2: ATP-dependent RNA helicase DBP2 (Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0911100`	ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034107 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006369 termination of RNA polymerase II transcription Biological Process

GO:0071042 nuclear polyadenylation-dependent mRNA catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0002151 G-quadruplex RNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

cgr:2890547

pic:PICST_82821

vpo:Kpol_165p1

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.419

Rank 1 · LXL04_034107 · OH-1004

Nucleus0.301

Rank 2 · LXL04_034107 · OH-1004

Mitochondrion0.132

Rank 3 · LXL04_034107 · OH-1004

Endoplasmic reticulum0.132

Rank 4 · LXL04_034107 · OH-1004

Cell membrane0.106

Rank 5 · LXL04_034107 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD213-273 aa

PF12146.16Hydrolase_4429-529 aa

PF00561.27Abhydrolase_1432-530 aa

PF12697.14Abhydrolase_6435-521 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034107	`PF00270.36`	DEAD	213	273	2.9e-12	47.3
LXL04_034107	`PF12146.16`	Hydrolase_4	429	529	9.7e-32	110.9
LXL04_034107	`PF00561.27`	Abhydrolase_1	432	530	1.3e-06	29.0
LXL04_034107	`PF12697.14`	Abhydrolase_6	435	521	1.7e-06	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5N7W4`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 30	36.879%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card