LXL04_034032 | RubberDandelionOmics

Gene overview

LXL04_034032

Reference: OH-1004 Chr: Chr07 Coordinates: 77034631-77037887 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

953 bp · LXL04_034032|LXL04_034032|OH1004|cDNA

CTTGTGGGATGACAACAGAATTATATATCAAAGAGTCCATGAGATTTAGCTACTCAGAGATTCATCTTGCTACAAATTATTTTTCAAAAGAAAACCTGTTAGGTGAAGGAGGTTATGGTCTTGTTTACAAGGGTCAGCTCGATGATGGCCAAATCATAGCTGCTAAAGTGCGTAAACAAGCAAGCACACAAGGATTTGAAGAATTCCATTCTGAAATTTATGTTTTGAGTTTTGCCCGCCATAGAAACATCGTCATGCTC...

CDS

Download CDS FASTA

945 bp · LXL04_034032|LXL04_034032|OH1004|CDS

ATGACAACAGAATTATATATCAAAGAGTCCATGAGATTTAGCTACTCAGAGATTCATCTTGCTACAAATTATTTTTCAAAAGAAAACCTGTTAGGTGAAGGAGGTTATGGTCTTGTTTACAAGGGTCAGCTCGATGATGGCCAAATCATAGCTGCTAAAGTGCGTAAACAAGCAAGCACACAAGGATTTGAAGAATTCCATTCTGAAATTTATGTTTTGAGTTTTGCCCGCCATAGAAACATCGTCATGCTCTTAGGATA...

Protein

Download Protein FASTA

314 aa · LXL04_034032|LXL04_034032|OH1004|PROTEIN

MTTELYIKESMRFSYSEIHLATNYFSKENLLGEGGYGLVYKGQLDDGQIIAAKVRKQASTQGFEEFHSEIYVLSFARHRNIVMLLGYCCKENINILVYEYICNRSLEWHLFDEATKVLEWRQRHAIAIGTAKGLRFLHEECRSSPIIHRDLRPSNILLTHDFVPMLGDFGLAKWKTNDSPIQTRILGTLGYLAPEYAENGMVSVRTDVYAYGITLIQIISGRKAVTVDTQDHHESLRQWAEPLVERLALHDLIDPRLGDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034032`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034032

Location Chr07:77034631-77037887 (-)

Description Similar to CDG1: Serine/threonine-protein kinase CDG1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At3g26940`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034032 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032502 developmental process Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23540

ath:AT1G70460

ath:AT3G26940

ath:AT5G38560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.486

Rank 1 · LXL04_034032 · OH-1004

Cytoplasm0.444

Rank 2 · LXL04_034032 · OH-1004

Nucleus0.279

Rank 3 · LXL04_034032 · OH-1004

Golgi apparatus0.039

Rank 4 · LXL04_034032 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_034032 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase26-292 aa

PF07714.24PK_Tyr_Ser-Thr28-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034032	`PF00069.32`	Pkinase	26	292	4.7e-40	138.4
LXL04_034032	`PF07714.24`	PK_Tyr_Ser-Thr	28	293	1.7e-36	126.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAL8`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK13	45.578%	Swiss-Prot	moderate database homology
`Q9ZUE0`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK12	44.178%	Swiss-Prot	moderate database homology
`Q9FFW5`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK8	43.448%	Swiss-Prot	moderate database homology
`Q9LSE1`	Arabidopsis thaliana	Serine/threonine-protein kinase CDG1	42.173%	Swiss-Prot	moderate database homology
`Q1PEM5`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK3	42.561%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card