LXL04_033849 | RubberDandelionOmics

Gene overview

LXL04_033849

Reference: OH-1004 Chr: Chr07 Coordinates: 60877345-60878149 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

517 bp · LXL04_033849|LXL04_033849|OH1004|cDNA

ATGACATATTGTCTTGAACATCCTGCAAGAAAGATGCTTCTTATGCCAGTTGAGCCATTTGAGCCGAATAAAtcttgctatgtttgttctGAGACGCCGTTATTGCTGGAAGTGAATACTCAGCGTGCAAAGCTGAGGGATGTGGTGGAGAAAGTGGTGACATCAAAGCTTGGGATGAATTTGCCATTAATCACTCATGGCTCAAGCCTTCTCTATGAAGTTGGTGATGATTTGGATCAAGATATGGTTGCTAATTATGA...

CDS

Download CDS FASTA

513 bp · LXL04_033849|LXL04_033849|OH1004|CDS

ATGACATATTGTCTTGAACATCCTGCAAGAAAGATGCTTCTTATGCCAGTTGAGCCATTTGAGCCGAATAAATCTTGCTATGTTTGTTCTGAGACGCCGTTATTGCTGGAAGTGAATACTCAGCGTGCAAAGCTGAGGGATGTGGTGGAGAAAGTGGTGACATCAAAGCTTGGGATGAATTTGCCATTAATCACTCATGGCTCAAGCCTTCTCTATGAAGTTGGTGATGATTTGGATCAAGATATGGTTGCTAATTATGA...

Protein

Download Protein FASTA

170 aa · LXL04_033849|LXL04_033849|OH1004|PROTEIN

MTYCLEHPARKMLLMPVEPFEPNKSCYVCSETPLLLEVNTQRAKLRDVVEKVVTSKLGMNLPLITHGSSLLYEVGDDLDQDMVANYEANLEKVLSELPYAITGGTVITVEDLQQELVCNINIKHRFVFDFYEEGIYVFFTYMKPVSPIFDGTIAASKSAIVNCFPCFFVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033849`
TK1151 ID	TkA01G606560
OH-1004 ID	LXL04_033849
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033849

Location Chr07:60877345-60878149 (-)

Description Similar to SAE2: SUMO-activating enzyme subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21470`	The dimeric enzyme acts as an E1 ligase for SUMO1 and SUMO2.	Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033849 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0033235 positive regulation of protein sumoylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0031510 SUMO activating enzyme complex Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016740 transferase activity Molecular Function

GO:0019948 SUMO activating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT2G21470

ddi:DDB_G0286919

hsa:10054

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.501

Rank 1 · LXL04_033849 · OH-1004

Nucleus0.452

Rank 2 · LXL04_033849 · OH-1004

Mitochondrion0.090

Rank 3 · LXL04_033849 · OH-1004

Cell membrane0.067

Rank 4 · LXL04_033849 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_033849 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14732.12UAE_UbL36-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033849	`PF14732.12`	UAE_UbL	36	125	6.8e-23	81.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJT1`	Arabidopsis thaliana	SUMO-activating enzyme subunit 2	73.810%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card