LXL04_033685 | RubberDandelionOmics

Gene overview

LXL04_033685

Reference: OH-1004 Chr: Chr07 Coordinates: 53078597-53079154 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

448 bp · LXL04_033685|LXL04_033685|OH1004|cDNA

ATGCCCCAAATGGTGTGGTTGACCTCTCCCAGAAATCCAAACGGGCAACATCCGTGTTTAGCGAGATCCGACCACCTCAACGAACGAAGAAGTGAACGATATCATGAAGCAACGATATTTTTATCGAAATCTAGAAAAATCGATTACGATGTGCTAATGGGAACGCCCACAGTTCAAGCTCTTAAAAGCGTGGCTCGCGATGGCCGGACTTTGATTTCTTCGATTCACCAACCGAGTAGTAAAGTTTTTGCATTGTTCGA...

CDS

Download CDS FASTA

360 bp · LXL04_033685|LXL04_033685|OH1004|CDS

ATGCCCCAAATGGTGTGGTTGACCTCTCCCAGAAATCCAAACGGGCAACATCCGTGTTTAGCGAGATCCGACCACCTCAACGAACGAAGAAGTGAACGATATCATGAAGCAACGATATTTTTATCGAAATCTAGAAAAATCGATTACGATGTGCTAATGGGAACGCCCACAGTTCAAGCTCTTAAAAGCGTGGCTCGCGATGGCCGGACTTTGATTTCTTCGATTCACCAACCGAGTAGTAAAGTTTTTGCATTGTTCGA...

Protein

Download Protein FASTA

119 aa · LXL04_033685|LXL04_033685|OH1004|PROTEIN

MPQMVWLTSPRNPNGQHPCLARSDHLNERRSERYHEATIFLSKSRKIDYDVLMGTPTVQALKSVARDGRTLISSIHQPSSKVFALFDDLFFAESGFPCPTKRNLVRSLFYGVSIRILML

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033685`
TK1151 ID	TkAUNG060210
OH-1004 ID	LXL04_033685
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 68.966 / OH-1004 84.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033685

Location Chr07:53078597-53079154 (+)

Description Similar to ABCG15: ABC transporter G family member 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21090`	ABC transporter G family member 15.	No verified direct reference in this release
`At1g51500`	Involved in the secretion of cuticular wax from epidermal cells to the cuticle, especially in the transport of aldehydes, alcohols and acids.	Cuticular waxes on eceriferum mutants of Arabidopsis thaliana.2001 · DOI: 10.1016/s0031-9422(00)00513-6 Plant cuticular lipid export requires an ABC transporter.2004 · DOI: 10.1126/science.1102331 Wax and cutin mutants of Arabidopsis: Quantitative characterization of the cuticular transport barrier in relation to chemical composition.2016 · DOI: 10.1016/j.bbalip.2016.03.002 The effects of surface structure mutations in Arabidopsis thaliana on the polarization of reflections from virus-infected leaves.2017 · DOI: 10.1371/journal.pone.0174014
`At1g17840`	Required for the cuticle, root suberin and pollen coat development by controlling cutin and maybe wax transport to the extracellular matrix.	Characterization of Arabidopsis ABCG11/WBC11, an ATP binding cassette (ABC) transporter that is required for cuticular lipid secretion.2007 · DOI: 10.1111/j.1365-313x.2007.03252.x The Arabidopsis DESPERADO/AtWBC11 transporter is required for cutin and wax secretion.2007 · DOI: 10.1104/pp.107.105676 Cytological and biochemical analysis of COF1, an Arabidopsis mutant of an ABC transporter gene.2007 · DOI: 10.1093/pcp/pcm139 An ABC transporter gene of Arabidopsis thaliana, AtWBC11, is involved in cuticle development and prevention of organ fusion.2007 · DOI: 10.1093/pcp/pcm152 The Arabidopsis DSO/ABCG11 transporter affects cutin metabolism in reproductive organs and suberin in roots.2010 · DOI: 10.1093/mp/ssp103 ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334 Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.2018 · DOI: 10.1007/s10265-017-0979-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033685 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing Biological Process

GO:0051607 defense response to virus Biological Process

GO:0055085 transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G17840

ath:AT1G51500

ath:AT3G21090

cel:CELE_C05D10.3

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.358

Rank 1 · LXL04_033685 · OH-1004

Nucleus0.277

Rank 2 · LXL04_033685 · OH-1004

Mitochondrion0.195

Rank 3 · LXL04_033685 · OH-1004

Endoplasmic reticulum0.085

Rank 4 · LXL04_033685 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_033685 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWI9`	Arabidopsis thaliana	ABC transporter G family member 15	57.576%	Swiss-Prot	weak database homology
`Q9C8K2`	Arabidopsis thaliana	ABC transporter G family member 12	55.224%	Swiss-Prot	weak database homology
`Q8RXN0`	Arabidopsis thaliana	ABC transporter G family member 11	48.438%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card