LXL04_033620 | RubberDandelionOmics

Gene overview

LXL04_033620

Reference: OH-1004 Chr: Chr07 Coordinates: 50264984-50271819 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2001 bp · LXL04_033620|LXL04_033620|OH1004|cDNA

ATGTCGCTTATTCAAGAACTCAACCACCTTAAAATTCCACTTGAAGACATCAAATTGGCCACAGAGAACTTTTCCGACAATAATTTCATCGGCCAGGGTGGATTCGGGAGGGTGTACAGTGGTCGCCTCCTTGTATCCACCTCTGCCACCACCTCAAGCAGCCAAGGCACCATGGTTGCTGTGAAAAGGTTAGACATGAAGTTTGGCCAAGGGCAACACGAGTTCTTGATGGAGATCGTCATGCTTGCAAGTTACAAACA...

CDS

Download CDS FASTA

2001 bp · LXL04_033620|LXL04_033620|OH1004|CDS

ATGTCGCTTATTCAAGAACTCAACCACCTTAAAATTCCACTTGAAGACATCAAATTGGCCACAGAGAACTTTTCCGACAATAATTTCATCGGCCAGGGTGGATTCGGGAGGGTGTACAGTGGTCGCCTCCTTGTATCCACCTCTGCCACCACCTCAAGCAGCCAAGGCACCATGGTTGCTGTGAAAAGGTTAGACATGAAGTTTGGCCAAGGGCAACACGAGTTCTTGATGGAGATCGTCATGCTTGCAAGTTACAAACA...

Protein

Download Protein FASTA

666 aa · LXL04_033620|LXL04_033620|OH1004|PROTEIN

MSLIQELNHLKIPLEDIKLATENFSDNNFIGQGGFGRVYSGRLLVSTSATTSSSQGTMVAVKRLDMKFGQGQHEFLMEIVMLASYKHDNVVSLVGFCDEGNEKIIVYEHEIHGSLDNHLESDLTWVQRINICLGAARGLNYLHSGVGEGHRVLHRDIKSSNVLLDENWKAKISDFGLSKIGPTNHVFTFLVTKACGTLGYLDPVYVSTGVLTKESDVYSFGVLLFEVLCGRLAVIGKYDDERRFLSHLARLRYEEGKIDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033620`
TK1151 ID	TkA08G286180
OH-1004 ID	LXL04_033620
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033620

Location Chr07:50264984-50271819 (+)

Description Similar to FER: Receptor-like protein kinase FERONIA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033620 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

KEGG gene cross-reference

ath:AT3G46290

ath:AT3G51550

ath:AT5G38990

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · LXL04_033620 · OH-1004

Cell membrane0.393

Rank 2 · LXL04_033620 · OH-1004

Nucleus0.307

Rank 3 · LXL04_033620 · OH-1004

Golgi apparatus0.053

Rank 4 · LXL04_033620 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_033620 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase26-301 aa

PF07714.24PK_Tyr_Ser-Thr28-303 aa

PF30950.1At1g65710358-421 aa

PF23197.2IG_AIR9459-535 aa

PF23080.1DUF7046577-665 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033620	`PF00069.32`	Pkinase	26	301	6e-42	144.6
LXL04_033620	`PF07714.24`	PK_Tyr_Ser-Thr	28	303	3.7e-43	148.4
LXL04_033620	`PF30950.1`	At1g65710	358	421	8.1e-13	48.9
LXL04_033620	`PF23197.2`	IG_AIR9	459	535	5.4e-10	39.7
LXL04_033620	`PF23080.1`	DUF7046	577	665	6.1e-15	56.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	43.046%	Swiss-Prot	weak database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	44.408%	Swiss-Prot	weak database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	43.377%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	44.408%	Swiss-Prot	weak database homology
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	41.694%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card