LXL04_033556 | RubberDandelionOmics

Gene overview

LXL04_033556

Reference: OH-1004 Chr: Chr07 Coordinates: 47591916-47593362 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · LXL04_033556|LXL04_033556|OH1004|cDNA

ATGAATCGAAGGCTGATTCAGGCAGCATGGAAAGGAGATGTCGATCAACTCCTTAAAGAGATCGACAACAACCCATGTGTTCTTCATGCCGTATCATTAGAGGGTGGCGAAACTCCATTACACATAGCTTCTTTCACCGGAGATCTCAACTTCACACAAACACTCATCAAACTAAGAAAGGAATTTTCATGGGAGCTTAACCAAGACGGGTTCACCCCTTTACACATAGCAGCCGCTTGTGGGCATACCCAAATTGTGAA...

CDS

Download CDS FASTA

1383 bp · LXL04_033556|LXL04_033556|OH1004|CDS

ATGAATCGAAGGCTGATTCAGGCAGCATGGAAAGGAGATGTCGATCAACTCCTTAAAGAGATCGACAACAACCCATGTGTTCTTCATGCCGTATCATTAGAGGGTGGCGAAACTCCATTACACATAGCTTCTTTCACCGGAGATCTCAACTTCACACAAACACTCATCAAACTAAGAAAGGAATTTTCATGGGAGCTTAACCAAGACGGGTTCACCCCTTTACACATAGCAGCCGCTTGTGGGCATACCCAAATTGTGAA...

Protein

Download Protein FASTA

460 aa · LXL04_033556|LXL04_033556|OH1004|PROTEIN

MNRRLIQAAWKGDVDQLLKEIDNNPCVLHAVSLEGGETPLHIASFTGDLNFTQTLIKLRKEFSWELNQDGFTPLHIAAACGHTQIVKELLNVDHGLCLIKGKDRKIPLHLAVVKGRVEVVRELLFASLDSVECATAQLQTSLHLAVKNNQFEAFQVLMQHLKIAMKENLLNSKDIHGNSILHLSVSMKQYEVVDFLLNGQVTSKEKIELNSLNKSGLTPLDMLLMFQSEAGDREIEEILIQAGALKSENLQSSTNTHVER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033556`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033556

Location Chr07:47591916-47593362 (-)

Description Similar to BAD1: Ankyrin repeat-containing protein BDA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54610`	Involved in plant defense.	No verified direct reference in this release
`At3g12360`	Involved in salt stress tolerance.	ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03614.x
`At2g01680`	Ankyrin repeat-containing protein At2g01680.	No verified direct reference in this release
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033556 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0045087 innate immune response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G01680

ath:AT3G12360

ath:AT5G02620

ath:AT5G54610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.834

Rank 1 · LXL04_033556 · OH-1004

Endoplasmic reticulum0.095

Rank 2 · LXL04_033556 · OH-1004

Cytoplasm0.079

Rank 3 · LXL04_033556 · OH-1004

Nucleus0.046

Rank 4 · LXL04_033556 · OH-1004

Lysosome / Vacuole0.035

Rank 5 · LXL04_033556 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_25-91 aa

PF13857.13Ank_567-111 aa

PF00023.37Ank69-91 aa

PF13606.13Ank_369-91 aa

PF12796.14Ank_2103-160 aa

PF13962.12PGG294-406 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033556	`PF12796.14`	Ank_2	5	91	3.2e-28	98.8
LXL04_033556	`PF13857.13`	Ank_5	67	111	7.6e-21	74.7
LXL04_033556	`PF00023.37`	Ank	69	91	1.4e-27	94.9
LXL04_033556	`PF13606.13`	Ank_3	69	91	2.9e-21	73.7
LXL04_033556	`PF12796.14`	Ank_2	103	160	3.2e-28	98.8
LXL04_033556	`PF13962.12`	PGG	294	406	1.9e-15	57.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYH5`	Arabidopsis thaliana	Ankyrin repeat-containing protein BDA1	31.034%	Swiss-Prot	moderate database homology
`Q9C7A2`	Arabidopsis thaliana	Ankyrin repeat-containing protein ITN1	23.733%	Swiss-Prot	weak database homology
`Q9ZU96`	Arabidopsis thaliana	Ankyrin repeat-containing protein At2g01680	21.719%	Swiss-Prot	weak database homology
`Q6AWW5`	Arabidopsis thaliana	Ankyrin repeat-containing protein At5g02620	26.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card