LXL04_033518 | RubberDandelionOmics

Gene overview

LXL04_033518

Reference: OH-1004 Chr: Chr07 Coordinates: 46080317-46084792 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1536 bp · LXL04_033518|LXL04_033518|OH1004|cDNA

ATGCATACAACGATTGTTAATTGCTCTAATGCTGCGCTGGTAGAAACGAGCATAGGGTTCGTGTTGCAGCTTGGGTCCGATACATCACTGCCTGGCTTGGTTGCTGCAAAAGTAGGTGCATATGTCGTTCTTACCGATGACTCCAACAGACTAGAGGTTCTAGAAAACATGAGAAAAGTGTGTGAGCTAAATAATATCAAATTTGAGGTATTTACTGTGAGGAATTTAATTTATGTTTCTGGTCTACTCGGAAAGCACCC...

CDS

Download CDS FASTA

1536 bp · LXL04_033518|LXL04_033518|OH1004|CDS

ATGCATACAACGATTGTTAATTGCTCTAATGCTGCGCTGGTAGAAACGAGCATAGGGTTCGTGTTGCAGCTTGGGTCCGATACATCACTGCCTGGCTTGGTTGCTGCAAAAGTAGGTGCATATGTCGTTCTTACCGATGACTCCAACAGACTAGAGGTTCTAGAAAACATGAGAAAAGTGTGTGAGCTAAATAATATCAAATTTGAGGTATTTACTGTGAGGAATTTAATTTATGTTTCTGGTCTACTCGGAAAGCACCC...

Protein

Download Protein FASTA

511 aa · LXL04_033518|LXL04_033518|OH1004|PROTEIN

MHTTIVNCSNAALVETSIGFVLQLGSDTSLPGLVAAKVGAYVVLTDDSNRLEVLENMRKVCELNNIKFEVFTVRNLIYVSGLLGKHPNLMEDFTTFLRHGFLAGALPYTVFQPQALELCARKVATSSGDMRNALGICRGAIERLETELRDDTCTSNLTSMVRFDHMAIALSRAYKSPIVRHNSAPSTTSTSKNHKSLQITNRGINEYLHWLPVSVHKQIYYIIRLIYTYSKLLFTNKGSKVKSLTGENSNNIGLSSILEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033518`
TK1151 ID	TkA03G033950
OH-1004 ID	LXL04_033518
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.100
Protein coverage (%)	TK1151 99.707 / OH-1004 89.237 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033518

Location Chr07:46080317-46084792 (-)

Description Similar to ELM1: Mitochondrial fission protein ELM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22350`	Plant-specific factor involved in mitochondria fission.	Arabidopsis ELONGATED MITOCHONDRIA1 is required for localization of DYNAMIN-RELATED PROTEIN3A to mitochondrial fission sites.2008 · DOI: 10.1105/tpc.108.058578
`At1g07270`	May be involved in the initiation of DNA replication.	No verified direct reference in this release
`At2g29680`	May be involved in the initiation of DNA replication.	Expression and stability of Arabidopsis CDC6 are associated with endoreplication.2001 · DOI: 10.1105/tpc.010329

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0856000`	May be involved in the initiation of DNA replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033518 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0033314 mitotic DNA replication checkpoint signaling Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0051301 cell division Biological Process

GO:0140530 MCM complex loading Biological Process

GO:1902975 mitotic DNA replication initiation Biological Process

GO:1902985 mitotic pre-replicative complex assembly Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005656 nuclear pre-replicative complex Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT1G07270

ath:AT2G29680

ath:AT5G22350

dosa:Os01g0856000

osa:4324832

spo:2540013

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.227

Rank 1 · LXL04_033518 · OH-1004

Cytoplasm0.214

Rank 2 · LXL04_033518 · OH-1004

Nucleus0.165

Rank 3 · LXL04_033518 · OH-1004

Mitochondrion0.138

Rank 4 · LXL04_033518 · OH-1004

Endoplasmic reticulum0.133

Rank 5 · LXL04_033518 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06258.18Mito_fiss_Elm1242-392 aa

PF06258.18Mito_fiss_Elm1405-505 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033518	`PF06258.18`	Mito_fiss_Elm1	242	392	2.7e-63	214.7
LXL04_033518	`PF06258.18`	Mito_fiss_Elm1	405	505	2.7e-63	214.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YN4`	Arabidopsis thaliana	Mitochondrial fission protein ELM1	56.022%	Swiss-Prot	moderate database homology
`Q8W032`	Arabidopsis thaliana	DNA replication factor CDC6B	56.962%	Swiss-Prot	weak database homology
`O82387`	Arabidopsis thaliana	DNA replication factor CDC6	51.250%	Swiss-Prot	weak database homology
`Q5N897`	Oryza sativa subsp. japonica	DNA replication factor CDC6	56.757%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card