LXL04_033465 | RubberDandelionOmics

Gene overview

LXL04_033465

Reference: OH-1004 Chr: Chr07 Coordinates: 44522058-44522627 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · LXL04_033465|LXL04_033465|OH1004|cDNA

ATGAGAGTTCTGATCTCCCATTTACATGCATATCTATACGTACTCAAGGAACATAATGAGAAAGATATGACTTACAAGATGTTTTCGCGTCAAAGTTTGACCGATTCATTGCTGGATCAGATCTTTAGCATCGATCTTTATTACGTAAATGCATTTCAAAATGCAGCAAGCACCATGGAAACCAGTGCTGTTGCAGCTGAGAATATTGCAAGATTGATCGTTTCAAGGCTATCTGGCTACCAGCCTTTGAAGTTATATGG...

CDS

Download CDS FASTA

306 bp · LXL04_033465|LXL04_033465|OH1004|CDS

ATGAGAGTTCTGATCTCCCATTTACATGCATATCTATACGTACTCAAGGAACATAATGAGAAAGATATGACTTACAAGATGTTTTCGCGTCAAAGTTTGACCGATTCATTGCTGGATCAGATCTTTAGCATCGATCTTTATTACGTAAATGCATTTCAAAATGCAGCAAGCACCATGGAAACCAGTGCTGTTGCAGCTGAGAATATTGCAAGATTGATCGTTTCAAGGCTATCTGGCTACCAGCCTTTGAAGTTATATGG...

Protein

Download Protein FASTA

101 aa · LXL04_033465|LXL04_033465|OH1004|PROTEIN

MRVLISHLHAYLYVLKEHNEKDMTYKMFSRQSLTDSLLDQIFSIDLYYVNAFQNAASTMETSAVAAENIARLIVSRLSGYQPLKLYGVKTSTSDLNLQRTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033465`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033465

Location Chr07:44522058-44522627 (+)

Description Similar to FLCY: Farnesylcysteine lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63910`	Involved in the degradation of prenylcysteine.	Arabidopsis thaliana plants possess a specific farnesylcysteine lyase that is involved in detoxification and recycling of farnesylcysteine.2007 · DOI: 10.1111/j.1365-313x.2007.03091.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033465 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0030327 prenylated protein catabolic process Biological Process

GO:0030328 prenylcysteine catabolic process Biological Process

GO:0045338 farnesyl diphosphate metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005764 lysosome Cellular Component

GO:0001735 prenylcysteine oxidase activity Molecular Function

GO:0102149 farnesylcysteine lyase activity Molecular Function

KEGG gene cross-reference

ath:AT5G63910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.217

Rank 1 · LXL04_033465 · OH-1004

Extracellular0.194

Rank 2 · LXL04_033465 · OH-1004

Endoplasmic reticulum0.178

Rank 3 · LXL04_033465 · OH-1004

Nucleus0.149

Rank 4 · LXL04_033465 · OH-1004

Lysosome / Vacuole0.139

Rank 5 · LXL04_033465 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07156.21Prenylcys_lyase46-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033465	`PF07156.21`	Prenylcys_lyase	46	78	1.2e-14	54.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57681`	Arabidopsis thaliana	Farnesylcysteine lyase	49.462%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card