LXL04_033456 | RubberDandelionOmics

Gene overview

LXL04_033456

Reference: OH-1004 Chr: Chr07 Coordinates: 44248919-44250261 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · LXL04_033456|LXL04_033456|OH1004|cDNA

ATGTCCGGCCAATCCGACCCTCGAGGTTCAACATTTTCAGCCGCTGAGTTGGAGTTTTTAGCGGAGGATGAAACCATAGAGATTGTTCCGAATCTAAGAATGGAACGCCTCAGTTTGATCTGCGGTGATTTTGGACCGTTTCGGCCCCAAATAGCTACTCAAGTTCCAATTTGGTTAGCCGTCGCTTTGAAGAAGCGAGGAAAATGCACAATTCGACCTCCAGATTGGATGTCTGTTGAAAAGTTGACTCAGGTGTTGGA...

CDS

Download CDS FASTA

633 bp · LXL04_033456|LXL04_033456|OH1004|CDS

ATGTCCGGCCAATCCGACCCTCGAGGTTCAACATTTTCAGCCGCTGAGTTGGAGTTTTTAGCGGAGGATGAAACCATAGAGATTGTTCCGAATCTAAGAATGGAACGCCTCAGTTTGATCTGCGGTGATTTTGGACCGTTTCGGCCCCAAATAGCTACTCAAGTTCCAATTTGGTTAGCCGTCGCTTTGAAGAAGCGAGGAAAATGCACAATTCGACCTCCAGATTGGATGTCTGTTGAAAAGTTGACTCAGGTGTTGGA...

Protein

Download Protein FASTA

210 aa · LXL04_033456|LXL04_033456|OH1004|PROTEIN

MSGQSDPRGSTFSAAELEFLAEDETIEIVPNLRMERLSLICGDFGPFRPQIATQVPIWLAVALKKRGKCTIRPPDWMSVEKLTQVLEAERDSASSFEALPFHYVEISRLLFDDARDDIPDVYMVRSLIEDIKDVRFHKIGTGLEKLSSRTYAMKLNLSAMEVNVIRPFVTGGLETFYKLGNPDLIQESSDRPQHRRPQPADRGPRRELRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033456`
TK1151 ID	TkA08G257990
OH-1004 ID	LXL04_033456
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033456

Location Chr07:44248919-44250261 (-)

Description Similar to GINS2: DNA replication complex GINS protein PSF2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12530`	The GINS complex plays an essential role in the initiation of DNA replication.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033456 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006260 DNA replication Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0032784 regulation of DNA-templated transcription elongation Biological Process

GO:0033260 nuclear DNA replication Biological Process

GO:0000785 chromatin Cellular Component

GO:0000811 GINS complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0043596 nuclear replication fork Cellular Component

GO:0071162 CMG complex Cellular Component

KEGG gene cross-reference

ath:AT3G12530

hsa:51659

mmu:272551

xla:444053

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · LXL04_033456 · OH-1004

Cytoplasm0.136

Rank 2 · LXL04_033456 · OH-1004

Mitochondrion0.017

Rank 3 · LXL04_033456 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_033456 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_033456 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25005.2PSF2_N14-71 aa

PF05916.17Sld576-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033456	`PF25005.2`	PSF2_N	14	71	2.1e-28	98.8
LXL04_033456	`PF05916.17`	Sld5	76	177	3.7e-14	53.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7A8`	Arabidopsis thaliana	DNA replication complex GINS protein PSF2	59.524%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card