LXL04_033432 | RubberDandelionOmics

Gene overview

LXL04_033432

Reference: OH-1004 Chr: Chr07 Coordinates: 43809513-43815416 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2103 bp · LXL04_033432|LXL04_033432|OH1004|cDNA

ATGTTCAGAAAGATCATTTCTTCCCATTCTAAGTCAAAGACAAGAAAATTTGTATCGATATCACATCATTCCACCAACTATTGCTACTACGATCACTCAGCACCACCTTCTTCCCCATCAAAACACATTTCCCCCAGACAAAAATGGCTTGATATCACACCAACTTCATTAAAGGGTTTCAATCGATCTTTTTCAGCTGGGTACCAGTTAAATTCGACGCAGTATAGTGGGTCTAATTCGAATAAAAGAAATAGGTTTTC...

CDS

Download CDS FASTA

2103 bp · LXL04_033432|LXL04_033432|OH1004|CDS

ATGTTCAGAAAGATCATTTCTTCCCATTCTAAGTCAAAGACAAGAAAATTTGTATCGATATCACATCATTCCACCAACTATTGCTACTACGATCACTCAGCACCACCTTCTTCCCCATCAAAACACATTTCCCCCAGACAAAAATGGCTTGATATCACACCAACTTCATTAAAGGGTTTCAATCGATCTTTTTCAGCTGGGTACCAGTTAAATTCGACGCAGTATAGTGGGTCTAATTCGAATAAAAGAAATAGGTTTTC...

Protein

Download Protein FASTA

700 aa · LXL04_033432|LXL04_033432|OH1004|PROTEIN

MFRKIISSHSKSKTRKFVSISHHSTNYCYYDHSAPPSSPSKHISPRQKWLDITPTSLKGFNRSFSAGYQLNSTQYSGSNSNKRNRFSVRRGFSSETVRECINYDVVIVGGGPAGLSAAIRLKQLCRESDVDLSVCVVEKGAEVGAHILSGNVFEPRALNELIPQWREEEAPISVSVSSDKFMLLTEKHAIPLPNPFDNKGNYVISLSQFVRWLGQKAEELGVEVYPGFAAKEVLFDENENVIGIATNDMGIGKDGSKKDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033432`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033432

Location Chr07:43809513-43815416 (-)

Description Similar to ETFQO: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43400`	Links fatty acid beta-oxidation and amino acid catabolism to the respiratory chain by transferring electrons from the electron transfer flavoprotein (ETF) to ubiquinone.	The critical role of Arabidopsis electron-transfer flavoprotein:ubiquinone oxidoreductase during dark-induced starvation.2005 · DOI: 10.1105/tpc.105.035162 Identification of the 2-hydroxyglutarate and isovaleryl-CoA dehydrogenases as alternative electron donors linking lysine catabolism to the electron transport chain of Arabidopsis mitochondria.2010 · DOI: 10.1105/tpc.110.075630

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0516300`	Links fatty acid beta-oxidation and amino acid catabolism to the respiratory chain by transferring electrons from the electron transfer flavoprotein (ETF) to ubiquinone.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033432 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009646 response to absence of light Biological Process

GO:0010230 alternative respiration Biological Process

GO:0022900 electron transport chain Biological Process

GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

KEGG gene cross-reference

ath:AT2G43400

ddi:DDB_G0278849

dosa:Os10g0516300

rno:295143

ssc:100515785

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.930

Rank 1 · LXL04_033432 · OH-1004

Cytoplasm0.055

Rank 2 · LXL04_033432 · OH-1004

Nucleus0.039

Rank 3 · LXL04_033432 · OH-1004

Plastid0.034

Rank 4 · LXL04_033432 · OH-1004

Cell membrane0.026

Rank 5 · LXL04_033432 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01946.24Thi495-153 aa

PF01266.31DAO104-146 aa

PF13450.13NAD_binding_8107-152 aa

PF21162.4ETFQO_UQ-bd303-396 aa

PF05187.20Fer4_ETF_QO532-631 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033432	`PF01946.24`	Thi4	95	153	1.7e-06	28.2
LXL04_033432	`PF01266.31`	DAO	104	146	2.2e-07	31.5
LXL04_033432	`PF13450.13`	NAD_binding_8	107	152	4.9e-07	30.7
LXL04_033432	`PF21162.4`	ETFQO_UQ-bd	303	396	3.9e-42	143.4
LXL04_033432	`PF05187.20`	Fer4_ETF_QO	532	631	3.6e-44	149.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22854`	Arabidopsis thaliana	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	73.875%	Swiss-Prot	strong database homology
`Q337B8`	Oryza sativa subsp. japonica	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	76.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card