Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2241 bp · LXL04_033402|LXL04_033402|OH1004|cDNA
ATGGCTTCCAGAGCAATTTTGAGACGACGAAGGCTTCTCACTGATTACTTCAACATTTCTGGTCGTTCAATTCAAGCCCTGAGCCATGGGCACTATACCAAATATTCAGACGTCGGTCACTCAAGCTCTACACCAGATAGCCCTTTCAAAGACTCCAGCAAGACAAAATCCGACCCTACAACATTTACAAGACATGAAGAATTTAACCGCTTCTCTACACTCGGATTCTTTACTCCCCATAGATTCAATTCAATTACACA...
2241 bp · LXL04_033402|LXL04_033402|OH1004|CDS
ATGGCTTCCAGAGCAATTTTGAGACGACGAAGGCTTCTCACTGATTACTTCAACATTTCTGGTCGTTCAATTCAAGCCCTGAGCCATGGGCACTATACCAAATATTCAGACGTCGGTCACTCAAGCTCTACACCAGATAGCCCTTTCAAAGACTCCAGCAAGACAAAATCCGACCCTACAACATTTACAAGACATGAAGAATTTAACCGCTTCTCTACACTCGGATTCTTTACTCCCCATAGATTCAATTCAATTACACA...
Protein
Download Protein FASTA746 aa · LXL04_033402|LXL04_033402|OH1004|PROTEIN
MASRAILRRRRLLTDYFNISGRSIQALSHGHYTKYSDVGHSSSTPDSPFKDSSKTKSDPTTFTRHEEFNRFSTLGFFTPHRFNSITQHRTFGHMSPLRDKLVFRPSNFSSMATAHQPDMRGEDEDKEQVSNKRKEASPEECDQAVEGLSSAKAKVKAKQVTESQKTAKSILQRTWSILLGIGPALKAVAAMSREDWAKKLVHWKSEFVSTLKHYWLGIKLLGVDVKISSRLLIKLAGGKSLSRRERQQLTRTTADIFRLV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033402 |
|---|---|
| TK1151 ID | TkA03G457560 |
| OH-1004 ID | LXL04_033402 |
| Relationship / confidence | Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033402 |
|---|---|
| Location | Chr07:43009417-43012632 (-) |
| Description | Similar to LETM1: Mitochondrial proton/calcium exchanger protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006813 potassium ion transport Biological Process GO:0006816 calcium ion transport Biological Process GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007007 inner mitochondrial membrane organization Biological Process GO:0034214 protein hexamerization Biological Process GO:0042407 cristae formation Biological Process GO:0051260 protein homooligomerization Biological Process GO:0051560 mitochondrial calcium ion homeostasis Biological Process GO:0051562 negative regulation of mitochondrial calcium ion concentration Biological Process GO:0099093 calcium export from the mitochondrion Biological Process GO:0140141 mitochondrial potassium ion transmembrane transport Biological Process |
| KEGG gene cross-reference | bta:513324 dre:570745 gga:422898 hsa:3954 xtr:780254 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07766.20LETM1_RBD241-475 aaPF13499.13EF-hand_7677-737 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_033402 | PF07766.20 | LETM1_RBD | 241 | 475 | 2.1e-86 | 290.0 |
| LXL04_033402 | PF13499.13 | EF-hand_7 | 677 | 737 | 3e-07 | 31.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.