LXL04_033400 | RubberDandelionOmics

Gene overview

LXL04_033400

Reference: OH-1004 Chr: Chr07 Coordinates: 42954752-42955855 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_033400|LXL04_033400|OH1004|cDNA

ATGAACCACAACCAGCAATCAAACGAAGCTAAACACAATGATGAAACTGCCCTCACAGATTTTCTTGCCTCATTAACAGACTACACCCCAACTATTCCTGATGAACTGGTGGAACATTACTTAGCGAAAAGTGGGTTTCAATGTCCAGATGTTCGATTAATAAGACTAGTTGCAGTTGCCGCTCAGAAGTTTGTCTCAGAGGTTGCCACTGAAGCTCTCCAGCAATGCAAGGCGAGACCAGCACCCGTGGTCAGGGACAA...

CDS

Download CDS FASTA

411 bp · LXL04_033400|LXL04_033400|OH1004|CDS

ATGAACCACAACCAGCAATCAAACGAAGCTAAACACAATGATGAAACTGCCCTCACAGATTTTCTTGCCTCATTAACAGACTACACCCCAACTATTCCTGATGAACTGGTGGAACATTACTTAGCGAAAAGTGGGTTTCAATGTCCAGATGTTCGATTAATAAGACTAGTTGCAGTTGCCGCTCAGAAGTTTGTCTCAGAGGTTGCCACTGAAGCTCTCCAGCAATGCAAGGCGAGACCAGCACCCGTGGTCAGGGACAA...

Protein

Download Protein FASTA

136 aa · LXL04_033400|LXL04_033400|OH1004|PROTEIN

MNHNQQSNEAKHNDETALTDFLASLTDYTPTIPDELVEHYLAKSGFQCPDVRLIRLVAVAAQKFVSEVATEALQQCKARPAPVVRDKKEKQQKDKRLIMNMDDLSKALQEYGVNVKHQEYFADSSSAGMESAQRDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033400`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033400

Location Chr07:42954752-42955855 (-)

Description Similar to TAF10: Transcription initiation factor TFIID subunit 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31720`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	The Arabidopsis mutant stg1 identifies a function for TBP-associated factor 10 in plant osmotic stress adaptation.2006 · DOI: 10.1093/pcp/pcj099 Temporary expression of the TAF10 gene and its requirement for normal development of Arabidopsis thaliana.2007 · DOI: 10.1093/pcp/pcl048

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033400 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006352 DNA-templated transcription initiation Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0010467 gene expression Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0036285 SAGA complex assembly Biological Process

KEGG gene cross-reference

ath:AT4G31720

dme:Dmel_CG2859

dme:Dmel_CG3069

hsa:6881

mmu:24075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · LXL04_033400 · OH-1004

Cytoplasm0.216

Rank 2 · LXL04_033400 · OH-1004

Mitochondrion0.020

Rank 3 · LXL04_033400 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_033400 · OH-1004

Golgi apparatus0.010

Rank 5 · LXL04_033400 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03540.20TAF1018-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033400	`PF03540.20`	TAF10	18	121	2.7e-38	130.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04173`	Arabidopsis thaliana	Transcription initiation factor TFIID subunit 10	78.676%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card