LXL04_033368 | RubberDandelionOmics

Gene overview

LXL04_033368

Reference: OH-1004 Chr: Chr07 Coordinates: 41761863-41763907 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1965 bp · LXL04_033368|LXL04_033368|OH1004|cDNA

ATGGATTCATCAAGTTCGATTATCCAAAGTGAAGAACTCTATTTAGCCAACTCCAAATTTGAATCATGTGATGAATTACTAAAGAATGTGCGGAGTTTTTATTATGACAAGGGATATGGATTATCTATTAAAGATTCAACTAAAGACAAATATGTCACATTGCAATGCGATCGAGGTGGTTCCTATCGAGATAGAATGGGTATTGGCGATAAAAGGAAGAAGAACACTGGGTCTCGTTTGATTAACTGCCCCTTCCAGAT...

CDS

Download CDS FASTA

1965 bp · LXL04_033368|LXL04_033368|OH1004|CDS

ATGGATTCATCAAGTTCGATTATCCAAAGTGAAGAACTCTATTTAGCCAACTCCAAATTTGAATCATGTGATGAATTACTAAAGAATGTGCGGAGTTTTTATTATGACAAGGGATATGGATTATCTATTAAAGATTCAACTAAAGACAAATATGTCACATTGCAATGCGATCGAGGTGGTTCCTATCGAGATAGAATGGGTATTGGCGATAAAAGGAAGAAGAACACTGGGTCTCGTTTGATTAACTGCCCCTTCCAGAT...

Protein

Download Protein FASTA

654 aa · LXL04_033368|LXL04_033368|OH1004|PROTEIN

MDSSSSIIQSEELYLANSKFESCDELLKNVRSFYYDKGYGLSIKDSTKDKYVTLQCDRGGSYRDRMGIGDKRKKNTGSRLINCPFQIVGKKGNDGTWVLKVKNLTHNHEPSTDMSGHPSFRRLLPDDVQSVKNMTLSGIPPRQILSSLRQRNQNLPAVSRTIYNLKAKIQKENLNNRSTVSALFEEFEKKGFIYDILYDSVGHITHLFVVHPLSIRLAKVFSNIFVMDCTYKTNKYKMPLLDIIGVSCFNTSFYSGFVFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033368`
TK1151 ID	TkA01G539460
OH-1004 ID	LXL04_033368
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	90.700
Protein coverage (%)	TK1151 97.800 / OH-1004 81.957 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033368

Location Chr07:41761863-41763907 (+)

Description Similar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32250`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At5g28530`	Putative protein FAR1-RELATED SEQUENCE 10.	No verified direct reference in this release
`At1g10240`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033368 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009403 toxin biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0004312 fatty acid synthase activity Molecular Function

GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function

GO:0008168 methyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

GO:0016874 ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10240

ath:AT2G32250

ath:AT4G38180

ath:AT5G28530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.947

Rank 1 · LXL04_033368 · OH-1004

Cytoplasm0.140

Rank 2 · LXL04_033368 · OH-1004

Mitochondrion0.021

Rank 3 · LXL04_033368 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_033368 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_033368 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056.4ZSWIM1-3_RNaseH-like189-308 aa

PF10551.16MULE225-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033368	`PF21056.4`	ZSWIM1-3_RNaseH-like	189	308	4.2e-11	43.6
LXL04_033368	`PF10551.16`	MULE	225	318	1.1e-25	90.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EBQ3`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 2	23.514%	Swiss-Prot	weak database homology
`Q9SZL8`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 5	20.930%	Swiss-Prot	weak database homology
`Q9LKR4`	Arabidopsis thaliana	Putative protein FAR1-RELATED SEQUENCE 10	21.891%	Swiss-Prot	weak database homology
`Q9SY66`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 11	22.993%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card