LXL04_033307 | RubberDandelionOmics

Gene overview

LXL04_033307

Reference: OH-1004 Chr: Chr07 Coordinates: 40549588-40550845 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · LXL04_033307|LXL04_033307|OH1004|cDNA

ATGGAATACAGAAACCTCGGTCGATCAGGATTGAAGGTATCGCAGCTCTCATACGGTGCATGGGTCAGTTTCGGCAACCAGTTGGACGTGAAAGAAGCCAAAACCCTACTCCAATGTTGCCGTGACAATGGCGTCAACTTCTTCGACAACGCAGAGGTCTACGCCAATGGCCGCGCCGAAGAAATCATGGGACAAGCGATCAGAGAACTCGGCTGGAAACGCTCTGATGTCGTTGTGTCTACTAAGTTGTTTTGGGGAGG...

CDS

Download CDS FASTA

984 bp · LXL04_033307|LXL04_033307|OH1004|CDS

ATGGAATACAGAAACCTCGGTCGATCAGGATTGAAGGTATCGCAGCTCTCATACGGTGCATGGGTCAGTTTCGGCAACCAGTTGGACGTGAAAGAAGCCAAAACCCTACTCCAATGTTGCCGTGACAATGGCGTCAACTTCTTCGACAACGCAGAGGTCTACGCCAATGGCCGCGCCGAAGAAATCATGGGACAAGCGATCAGAGAACTCGGCTGGAAACGCTCTGATGTCGTTGTGTCTACTAAGTTGTTTTGGGGAGG...

Protein

Download Protein FASTA

327 aa · LXL04_033307|LXL04_033307|OH1004|PROTEIN

MEYRNLGRSGLKVSQLSYGAWVSFGNQLDVKEAKTLLQCCRDNGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDVVVSTKLFWGGPGPNDKGLSRKHIIEGTKASLKRLDMEYVDLIYCHRPDLQTPIEETVRAMNHVIDKGLAFYWGTSEWSAQQITEAWGVANRLDLVGPIVEQPEYNMFARHKVENEYLPLYSTYGMGLTTWSPLASGVLTGKYNAGVPADSRFALENYKNLASRSLVDDVLKKVKNLKPIADEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033307`
TK1151 ID	TkA08G249560
OH-1004 ID	LXL04_033307
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033307

Location Chr07:40549588-40550845 (-)

Description Similar to KAB1: Probable voltage-gated potassium channel subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04690`	Probable accessory potassium channel protein which modulates the activity of the pore-forming alpha subunit.	Physical association of KAB1 with plant K+ channel alpha subunits.1996 · DOI: 10.1105/tpc.8.9.1545

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0817500`	Probable accessory potassium channel protein which modulates the activity of the pore-forming alpha subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033307 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:1901379 regulation of potassium ion transmembrane transport Biological Process

GO:2000008 regulation of protein localization to cell surface Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008076 voltage-gated potassium channel complex Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G04690

bta:541597

dosa:Os02g0817500

mmu:16498

rno:29738

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.779

Rank 1 · LXL04_033307 · OH-1004

Nucleus0.278

Rank 2 · LXL04_033307 · OH-1004

Cell membrane0.114

Rank 3 · LXL04_033307 · OH-1004

Mitochondrion0.061

Rank 4 · LXL04_033307 · OH-1004

Lysosome / Vacuole0.047

Rank 5 · LXL04_033307 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248.28Aldo_ket_red16-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033307	`PF00248.28`	Aldo_ket_red	16	316	3.9e-65	220.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23016`	Arabidopsis thaliana	Probable voltage-gated potassium channel subunit beta	83.841%	Swiss-Prot	strong database homology
`Q40648`	Oryza sativa subsp. japonica	Probable voltage-gated potassium channel subunit beta	83.232%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card