LXL04_033280 | RubberDandelionOmics

Gene overview

LXL04_033280

Reference: OH-1004 Chr: Chr07 Coordinates: 40266584-40267236 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · LXL04_033280|LXL04_033280|OH1004|cDNA

ATGGCGCAATATCAAAAAATACCATCGATCACAGTGTTGCTAGCGATCACAATTGCAACCCATTATGGTGGCGCAATGGCTCAATCATCAGGGTGCACAAGTGCGCTAGTTAGCCTTTCCCCATGCCTTAACTACCTCTCAGGCAACACATCAACACCATCATCAGGATGTTGCAGCCAACTTGCGAATGTGGTTCAGTCACAGCCACAGTGCTTGTGTGAAGTCCTTAATGGTGGTGGCTCATCTTTGGGTCTTAGCAT...

CDS

Download CDS FASTA

495 bp · LXL04_033280|LXL04_033280|OH1004|CDS

ATGGCGCAATATCAAAAAATACCATCGATCACAGTGTTGCTAGCGATCACAATTGCAACCCATTATGGTGGCGCAATGGCTCAATCATCAGGGTGCACAAGTGCGCTAGTTAGCCTTTCCCCATGCCTTAACTACCTCTCAGGCAACACATCAACACCATCATCAGGATGTTGCAGCCAACTTGCGAATGTGGTTCAGTCACAGCCACAGTGCTTGTGTGAAGTCCTTAATGGTGGTGGCTCATCTTTGGGTCTTAGCAT...

Protein

Download Protein FASTA

164 aa · LXL04_033280|LXL04_033280|OH1004|PROTEIN

MAQYQKIPSITVLLAITIATHYGGAMAQSSGCTSALVSLSPCLNYLSGNTSTPSSGCCSQLANVVQSQPQCLCEVLNGGGSSLGLSINQTQALAIPEACNVQTPPTSRCNVGSPGNSPTPGTIGVPSGKGVPSTNNGSSDAYLTKFTAIPIVSLLLVATYAVVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033280`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033280

Location Chr07:40266584-40267236 (+)

Description Similar to At2g13820: Non-specific lipid-transfer protein-like protein At2g13820

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22600`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740
`At4g14815`	Probable lipid transfer protein.	No verified direct reference in this release
`At1g03103`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g48130`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g13820`	Probable lipid transfer protein (By similarity).	Expression and genome-wide analysis of the xylogen-type gene family.2011 · DOI: 10.1093/pcp/pcr060

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033280 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0006508 proteolysis Biological Process

GO:0006869 lipid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0009845 seed germination Biological Process

GO:0010089 xylem development Biological Process

GO:0010214 seed coat development Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G03103

ath:AT2G13820

ath:AT2G48130

ath:AT3G22600

ath:AT4G14815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.647

Rank 1 · LXL04_033280 · OH-1004

Endoplasmic reticulum0.121

Rank 2 · LXL04_033280 · OH-1004

Extracellular0.113

Rank 3 · LXL04_033280 · OH-1004

Cytoplasm0.089

Rank 4 · LXL04_033280 · OH-1004

Lysosome / Vacuole0.062

Rank 5 · LXL04_033280 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_220-109 aa

PF00234.28Tryp_alpha_amyl32-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033280	`PF14368.12`	LTP_2	20	109	5.9e-20	71.9
LXL04_033280	`PF00234.28`	Tryp_alpha_amyl	32	109	9.8e-13	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJ86`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 5	45.562%	Swiss-Prot	moderate database homology
`Q2PE59`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 26	44.872%	Swiss-Prot	moderate database homology
`F4HZB9`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 19	43.787%	Swiss-Prot	moderate database homology
`Q7EB72`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 15	43.411%	Swiss-Prot	moderate database homology
`Q9ZQI8`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 11	30.723%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card