LXL04_033277 | RubberDandelionOmics

Gene overview

LXL04_033277

Reference: OH-1004 Chr: Chr07 Coordinates: 40187603-40189613 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · LXL04_033277|LXL04_033277|OH1004|cDNA

ATGCGATTGTCGGTTTCTGTGTCGCCGTTCTCCTTCACTGAGCTTTCTATCTCCGCCTTTTCCACCATCGATGTTTATTTTCGAATTCCTGTTTCTTTTCTCTTCACTGGTCCATTTGTGCTCTTTCGGTTACATAATCCTCTATTCTCCCGGTTTGGTAGGCTTGTGAACACAGCATTAAAGGCAAAGGAGCTATGTACATTGTTGATGAATGTATTTGTGTCAAATGAAAATATGCGGAAATCCTTATTATGTATTGG...

CDS

Download CDS FASTA

582 bp · LXL04_033277|LXL04_033277|OH1004|CDS

ATGCGATTGTCGGTTTCTGTGTCGCCGTTCTCCTTCACTGAGCTTTCTATCTCCGCCTTTTCCACCATCGATGTTTATTTTCGAATTCCTGTTTCTTTTCTCTTCACTGGTCCATTTGTGCTCTTTCGGTTACATAATCCTCTATTCTCCCGGTTTGGTAGGCTTGTGAACACAGCATTAAAGGCAAAGGAGCTATGTACATTGTTGATGAATGTATTTGTGTCAAATGAAAATATGCGGAAATCCTTATTATGTATTGG...

Protein

Download Protein FASTA

193 aa · LXL04_033277|LXL04_033277|OH1004|PROTEIN

MRLSVSVSPFSFTELSISAFSTIDVYFRIPVSFLFTGPFVLFRLHNPLFSRFGRLVNTALKAKELCTLLMNVFVSNENMRKSLLCIGSYQFKVSNGDCIYTEKLKFCELILNKVLMLGSSNQTMIGRPVLPEANVHALVEKHKKRRKNYRRTKGHRQELTKLRIIDIQGIEKPEIPTMEKATTNKVEKTVVAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033277`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033277

Location Chr07:40187603-40189613 (-)

Description Similar to RPL21M: 50S ribosomal protein L21, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30930`	This protein binds to 23S ribosomal RNA in the presence of protein L20 (By similarity).	NUCLEAR FUSION DEFECTIVE1 encodes the Arabidopsis RPL21M protein and is required for karyogamy during female gametophyte development and fertilization.2006 · DOI: 10.1104/pp.106.079319

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033277 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0006412 translation Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

KEGG gene cross-reference

ath:AT4G30930

ckl:CKL_0879

mag:amb4077

pca:Pcar_2583

rce:RC1_0448

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.309

Rank 1 · LXL04_033277 · OH-1004

Mitochondrion0.254

Rank 2 · LXL04_033277 · OH-1004

Nucleus0.236

Rank 3 · LXL04_033277 · OH-1004

Plastid0.192

Rank 4 · LXL04_033277 · OH-1004

Endoplasmic reticulum0.032

Rank 5 · LXL04_033277 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00829.27Ribosomal_L21p86-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033277	`PF00829.27`	Ribosomal_L21p	86	167	8.4e-17	62.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9A0`	Arabidopsis thaliana	Large ribosomal subunit protein bL21m	50.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card