LXL04_033255 | RubberDandelionOmics

Gene overview

LXL04_033255

Reference: OH-1004 Chr: Chr07 Coordinates: 39415888-39418252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1349 bp · LXL04_033255|LXL04_033255|OH1004|cDNA

AAATACTATTATAGCTGAAATTAAAAATGGTTGCTAATCATATATGTTCTTTTCTAAATTTCTTGCAGCTTGGATCGATGAAAACAGCTTTGAATTTCCGTGACCTTATAATCTTTTCGGCCTTTTTACGTGTGTTTTTAATTGTGTATGGAGAATGGCAAGACACTCATATGGAAGTTAGGTATACAGATGTTGATTACCTTGTTTTCTCAGATGCTGCAACTTTAGTAGTTTCTGGAAAATCCCCGTATAAAAGATCC...

CDS

Download CDS FASTA

1335 bp · LXL04_033255|LXL04_033255|OH1004|CDS

CTGAAATTAAAAATGGTTGCTAATCATATATGTTCTTTTCTAAATTTCTTGCAGCTTGGATCGATGAAAACAGCTTTGAATTTCCGTGACCTTATAATCTTTTCGGCCTTTTTACGTGTGTTTTTAATTGTGTATGGAGAATGGCAAGACACTCATATGGAAGTTAGGTATACAGATGTTGATTACCTTGTTTTCTCAGATGCTGCAACTTTAGTAGTTTCTGGAAAATCCCCGTATAAAAGATCCACATATCGATACTC...

Protein

Download Protein FASTA

444 aa · LXL04_033255|LXL04_033255|OH1004|PROTEIN

MKLKMVANHICSFLNFLQLGSMKTALNFRDLIIFSAFLRVFLIVYGEWQDTHMEVRYTDVDYLVFSDAATLVVSGKSPYKRSTYRYSPLIAFLLTPNSFIHRSWGKFLFSASDLLVGYFIRKVLKLRGVPEKLCIYSVIVWLFNPFTFTIGTRGNCEPIVCAIILWVIICLMKGNLFQGAIWYGLVVHMRIYPIIYSLPILIILDPSHFQPNKNPALVNWKSKQRPPPGPTKSSNLIMTLFSRSRILFSLTSASVFFFFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033255`
TK1151 ID	TkA08G244310
OH-1004 ID	LXL04_033255
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 81.667 / OH-1004 44.144 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033255

Location Chr07:39415888-39418252 (-)

Description Similar to PIGM: GPI mannosyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22130`	Mannosyltransferase involved in glycosylphosphatidylinositol- anchor biosynthesis.	Glycosylphosphatidylinositol-anchored proteins are required for cell wall synthesis and morphogenesis in Arabidopsis.2005 · DOI: 10.1105/tpc.105.031815

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033255 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006506 GPI anchor biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0051301 cell division Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:1990529 glycosylphosphatidylinositol-mannosyltransferase I complex Cellular Component

GO:0000030 mannosyltransferase activity Molecular Function

GO:0004376 GPI mannosyltransferase activity Molecular Function

GO:0051751 alpha-1,4-mannosyltransferase activity Molecular Function

GO:0180041 dol-P-Man:GlcN-acyl-PI alpha-1,4-mannosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G22130

ddi:DDB_G0288899

xtr:493482

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.878

Rank 1 · LXL04_033255 · OH-1004

Nucleus0.075

Rank 2 · LXL04_033255 · OH-1004

Golgi apparatus0.067

Rank 3 · LXL04_033255 · OH-1004

Cytoplasm0.062

Rank 4 · LXL04_033255 · OH-1004

Cell membrane0.041

Rank 5 · LXL04_033255 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06728.20PIG-U38-383 aa

PF05007.20Mannosyl_trans150-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033255	`PF06728.20`	PIG-U	38	383	3.8e-11	43.4
LXL04_033255	`PF05007.20`	Mannosyl_trans	150	428	8.8e-74	249.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q500W7`	Arabidopsis thaliana	GPI mannosyltransferase 1	69.121%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card