LXL04_033253 | RubberDandelionOmics

Gene overview

LXL04_033253

Reference: OH-1004 Chr: Chr07 Coordinates: 39393387-39404717 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2979 bp · LXL04_033253|LXL04_033253|OH1004|cDNA

ATGGAACATCAACTCCTCCAAATCTTCTTACAAGGAAATATGGTGTCACAAAACTCCATTTACGACATCAAAATCTCTAGCGTTGTTCCTGGGTTCATATCCGGGAACAATGAATTGCATGAGCTAACAGCCATGGACCTAACCATGAAGCTTCATTACCTTCGGTTCGTCTACTACTTCACAACACCCGCATTTGAAGGTCTAACAACCGTGAACATTAAGGAAACAATGTTCCATTGGTTAAGCCATGCATATATCCC...

CDS

Download CDS FASTA

2979 bp · LXL04_033253|LXL04_033253|OH1004|CDS

ATGGAACATCAACTCCTCCAAATCTTCTTACAAGGAAATATGGTGTCACAAAACTCCATTTACGACATCAAAATCTCTAGCGTTGTTCCTGGGTTCATATCCGGGAACAATGAATTGCATGAGCTAACAGCCATGGACCTAACCATGAAGCTTCATTACCTTCGGTTCGTCTACTACTTCACAACACCCGCATTTGAAGGTCTAACAACCGTGAACATTAAGGAAACAATGTTCCATTGGTTAAGCCATGCATATATCCC...

Protein

Download Protein FASTA

992 aa · LXL04_033253|LXL04_033253|OH1004|PROTEIN

MEHQLLQIFLQGNMVSQNSIYDIKISSVVPGFISGNNELHELTAMDLTMKLHYLRFVYYFTTPAFEGLTTVNIKETMFHWLSHAYIPCGRFRRAKSGRPFIKCNDGGLRIIEARCHLSLDEWLDSKHDSRHQFLVPNNVIGPDIAFSPLVMIQLTKFKCGATSIGLSWSHVLGDAHSAVAFLGLWAQAIAHHYPTQPLTMDKQHIQAHNFQSLDSTIDMLSVKRVGPVGDLWSTSSNTKMETFSFHISMSKLTQLQEKVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033253`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033253

Location Chr07:39393387-39404717 (-)

Description Similar to CER26: Protein ECERIFERUM 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13840`	Involved in biosynthesis of the epicuticular wax.	The Arabidopsis cer26 mutant, like the cer2 mutant, is specifically affected in the very long chain fatty acid elongation process.2013 · DOI: 10.1111/tpj.12060
`At3g23840`	Involved in biosynthesis of the epicuticular wax.	No verified direct reference in this release
`At4g24510`	Involved in biosynthesis of the epicuticular wax.	Composition of alkyl esters in the cuticular wax on inflorescence stems of Arabidopsis thaliana cer mutants.2007 · DOI: 10.1111/j.1365-313x.2007.03054.x Arabidopsis ECERIFERUM2 is a component of the fatty acid elongation machinery required for fatty acid extension to exceptional lengths.2012 · DOI: 10.1104/pp.112.201640 The Arabidopsis cer26 mutant, like the cer2 mutant, is specifically affected in the very long chain fatty acid elongation process.2013 · DOI: 10.1111/tpj.12060

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033253 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

ath:AT3G23840

ath:AT4G13840

ath:AT4G24510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.598

Rank 1 · LXL04_033253 · OH-1004

Nucleus0.263

Rank 2 · LXL04_033253 · OH-1004

Cell membrane0.178

Rank 3 · LXL04_033253 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_033253 · OH-1004

Lysosome / Vacuole0.068

Rank 5 · LXL04_033253 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase41-410 aa

PF02458.21Transferase578-977 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033253	`PF02458.21`	Transferase	41	410	3.3e-68	231.1
LXL04_033253	`PF02458.21`	Transferase	578	977	3.3e-68	231.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVM9`	Arabidopsis thaliana	Protein ECERIFERUM 26	37.559%	Swiss-Prot	weak database homology
`Q9LIS1`	Arabidopsis thaliana	Protein ECERIFERUM 26-like	37.722%	Swiss-Prot	weak database homology
`Q39048`	Arabidopsis thaliana	Protein ECERIFERUM 2	35.514%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card