LXL04_033232 | RubberDandelionOmics

Gene overview

LXL04_033232

Reference: OH-1004 Chr: Chr07 Coordinates: 38938534-38938923 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · LXL04_033232|LXL04_033232|OH1004|cDNA

ATGACAAATCTCTCAATCATAACCTTTTCACTCGTAATTTTGGCTTCGAGTATTGTAGCCAACGGAATTCCAGGCGGGAGAACGAAAGTAACGGATGTGAAGTCGAACAAGGAGCTTCAGGAGCTCGGGAGGTACTCGGTGCTGGAGTACAACCGCATGCAGCGGATCTCATCGGGGAAAAACGACGGAGATCTGATGTTTTCGCAGGTGGTGGAGGCGGAGAAACAGGTGGTGTCAGGGATGAAATACTACCTGAAGAT...

CDS

Download CDS FASTA

390 bp · LXL04_033232|LXL04_033232|OH1004|CDS

ATGACAAATCTCTCAATCATAACCTTTTCACTCGTAATTTTGGCTTCGAGTATTGTAGCCAACGGAATTCCAGGCGGGAGAACGAAAGTAACGGATGTGAAGTCGAACAAGGAGCTTCAGGAGCTCGGGAGGTACTCGGTGCTGGAGTACAACCGCATGCAGCGGATCTCATCGGGGAAAAACGACGGAGATCTGATGTTTTCGCAGGTGGTGGAGGCGGAGAAACAGGTGGTGTCAGGGATGAAATACTACCTGAAGAT...

Protein

Download Protein FASTA

129 aa · LXL04_033232|LXL04_033232|OH1004|PROTEIN

MTNLSIITFSLVILASSIVANGIPGGRTKVTDVKSNKELQELGRYSVLEYNRMQRISSGKNDGDLMFSQVVEAEKQVVSGMKYYLKIEAFSKTSEDPKVFEAVVVVKPWLRSKQLQSFAPSSVISQLIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033232`
TK1151 ID	TkA08G243000
OH-1004 ID	LXL04_033232
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033232

Location Chr07:38938534-38938923 (+)

Description Similar to Cysteine proteinase inhibitor B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31980`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0350100`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`UniProt: A2XS65`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`Os01g0915200`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033232 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT2G31980

dosa:Os01g0915200

dosa:Os04g0350100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.329

Rank 1 · LXL04_033232 · OH-1004

Lysosome / Vacuole0.298

Rank 2 · LXL04_033232 · OH-1004

Endoplasmic reticulum0.193

Rank 3 · LXL04_033232 · OH-1004

Cytoplasm0.184

Rank 4 · LXL04_033232 · OH-1004

Cell membrane0.103

Rank 5 · LXL04_033232 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16845.12SQAPI35-119 aa

PF00031.28Cystatin35-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033232	`PF16845.12`	SQAPI	35	119	6e-16	59.3
LXL04_033232	`PF00031.28`	Cystatin	35	118	2.3e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5T9`	Arabidopsis thaliana	Cysteine proteinase inhibitor 2	42.453%	Swiss-Prot	moderate database homology
`P0C579`	Oryza sativa subsp. japonica	Cysteine proteinase inhibitor 10	49.107%	Swiss-Prot	moderate database homology
`A2XS65`	Oryza sativa subsp. indica	Cysteine proteinase inhibitor 10	49.107%	Swiss-Prot	moderate database homology
`Q5N806`	Oryza sativa subsp. japonica	Cysteine proteinase inhibitor 4	50.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card