LXL04_033231 | RubberDandelionOmics

Gene overview

LXL04_033231

Reference: OH-1004 Chr: Chr07 Coordinates: 38927693-38933263 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3330 bp · LXL04_033231|LXL04_033231|OH1004|cDNA

ATGAAGAAGCCACCAAGAAGCGCgatattgagagagaattttCACGATATGCCACCACAAAACCCTAGTTCGATGAAGCAAAATAGATCTTCAAATCGGAAGCAGAAACATTCCAAAGAAAATGCTCCTCCTTCCAATATGAACGCCATTCCAGATTCATCTCCTAATCCATCATTCACTGGTAAACCCTCTCCGTCTGTTGTTAGTAAATTGAAATCTCTGCTCCCACCAAGGCCACCTTCGTCAAATCCTCTAAAACG...

CDS

Download CDS FASTA

3330 bp · LXL04_033231|LXL04_033231|OH1004|CDS

ATGAAGAAGCCACCAAGAAGCGCGATATTGAGAGAGAATTTTCACGATATGCCACCACAAAACCCTAGTTCGATGAAGCAAAATAGATCTTCAAATCGGAAGCAGAAACATTCCAAAGAAAATGCTCCTCCTTCCAATATGAACGCCATTCCAGATTCATCTCCTAATCCATCATTCACTGGTAAACCCTCTCCGTCTGTTGTTAGTAAATTGAAATCTCTGCTCCCACCAAGGCCACCTTCGTCAAATCCTCTAAAACG...

Protein

Download Protein FASTA

1109 aa · LXL04_033231|LXL04_033231|OH1004|PROTEIN

MKKPPRSAILRENFHDMPPQNPSSMKQNRSSNRKQKHSKENAPPSNMNAIPDSSPNPSFTGKPSPSVVSKLKSLLPPRPPSSNPLKRKIGTDFQPENGVPGSSDTGVKVIVRMRPLSKNEEGEMIVQKTSGDSLSILGQQFTFDHVADTSANQMDIFQLVGAPLVENCLAGFNSSIFAYGQTGSGKTFTIWGPTNALLEENSSSDDQGLTPRVFERLFSRINEEQDKHADKQLMYQCRCSFLEIYNEQITDLLNPSQKNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033231`
TK1151 ID	TkA08G242920
OH-1004 ID	LXL04_033231
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033231

Location Chr07:38927693-38933263 (-)

Description Similar to KIN12B: Kinesin-like protein KIN-12B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23670`	Plus-end directed kinesin-like motor enzyme that plays a critical role in the organization of phragmoplast microtubules during cytokinesis.	Two Arabidopsis phragmoplast-associated kinesins play a critical role in cytokinesis during male gametogenesis.2007 · DOI: 10.1105/tpc.107.050716
`At4g14150`	Plus-end directed kinesin-like motor enzyme that plays a critical role in the organization of phragmoplast microtubules during cytokinesis.	Identification of a phragmoplast-associated kinesin-related protein in higher plants.2000 · DOI: 10.1016/s0960-9822(00)00564-9 Two Arabidopsis phragmoplast-associated kinesins play a critical role in cytokinesis during male gametogenesis.2007 · DOI: 10.1105/tpc.107.050716

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0350300`	Plus-end directed kinesin-like motor enzyme that plays a critical role in the organization of phragmoplast microtubules during cytokinesis.	No verified direct reference in this release
`Os02g0489800`	Kinesin-like protein KIN-12B.	No verified direct reference in this release
`Os03g0587200`	Kinesin-like protein KIN-12C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033231 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007112 male meiosis cytokinesis Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0080175 phragmoplast microtubule organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT3G23670

ath:AT4G14150

dosa:Os02g0489800

dosa:Os04g0350300

osa:9270703

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608

Rank 1 · LXL04_033231 · OH-1004

Nucleus0.354

Rank 2 · LXL04_033231 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_033231 · OH-1004

Golgi apparatus0.052

Rank 4 · LXL04_033231 · OH-1004

Mitochondrion0.049

Rank 5 · LXL04_033231 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd107-253 aa

PF00225.30Kinesin135-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033231	`PF16796.12`	Microtub_bd	107	253	5.6e-22	79.0
LXL04_033231	`PF00225.30`	Kinesin	135	440	1.6e-107	360.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7Y8`	Arabidopsis thaliana	Kinesin-like protein KIN-12B	53.243%	Swiss-Prot	strong database homology
`Q9LDN0`	Arabidopsis thaliana	Kinesin-like protein KIN-12A	67.885%	Swiss-Prot	weak database homology
`Q7XKR9`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-12A	48.567%	Swiss-Prot	moderate database homology
`Q6K765`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-12B	60.232%	Swiss-Prot	weak database homology
`Q5W6L9`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-12C	34.647%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card