LXL04_033219 | RubberDandelionOmics

Gene overview

LXL04_033219

Reference: OH-1004 Chr: Chr07 Coordinates: 38524013-38527334 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1581 bp · LXL04_033219|LXL04_033219|OH1004|cDNA

ATGCCCCACAATTTCAAAATCATGTTACTTCTTATTCCATGGTGGACCGACCTGGTTATCCGATGTCGGTTTTCGTACGCTGGGAAGGTTGCGTGGTTGGATTTGAACCATAGCCGAGTCAGACCTCTTTACTATACTACTCTCACTTGTACCGTACAACTCACAGATGCATTCCTAACCCCTTTTAAGACCACAAAATTCATCCTCCATGACCCAAAAAACCTCCCACTCAACTCGTCAAAAACCAACCCATTTTCCCT...

CDS

Download CDS FASTA

1581 bp · LXL04_033219|LXL04_033219|OH1004|CDS

ATGCCCCACAATTTCAAAATCATGTTACTTCTTATTCCATGGTGGACCGACCTGGTTATCCGATGTCGGTTTTCGTACGCTGGGAAGGTTGCGTGGTTGGATTTGAACCATAGCCGAGTCAGACCTCTTTACTATACTACTCTCACTTGTACCGTACAACTCACAGATGCATTCCTAACCCCTTTTAAGACCACAAAATTCATCCTCCATGACCCAAAAAACCTCCCACTCAACTCGTCAAAAACCAACCCATTTTCCCT...

Protein

Download Protein FASTA

526 aa · LXL04_033219|LXL04_033219|OH1004|PROTEIN

MPHNFKIMLLLIPWWTDLVIRCRFSYAGKVAWLDLNHSRVRPLYYTTLTCTVQLTDAFLTPFKTTKFILHDPKNLPLNSSKTNPFSLQTNMINFDDLYSVLTAVVPLYVTMFLAYASVKWNIFSPQQCGGINRFVAIFAVPLLSFEFISRINPYKMNLKFIAADGVSKILTLFVLFLWTNLSKNGNLDWAITMFSLSTLPNTLVMGIPLLKSMYGDDKESIMVQAVVLQCIIWYTLLLFLFEYREAKNLILTGGSGNSNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033219`
TK1151 ID	TkA08G242080
OH-1004 ID	LXL04_033219
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 74.525 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033219

Location Chr07:38524013-38527334 (-)

Description Similar to PIN9: Probable auxin efflux carrier component 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01420`	Acts as a component of the auxin efflux carrier.	Differential auxin-transporting activities of PIN-FORMED proteins in Arabidopsis root hair cells.2010 · DOI: 10.1104/pp.110.156505 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 Root System Depth in Arabidopsis Is Shaped by EXOCYST70A3 via the Dynamic Modulation of Auxin Transport.2019 · DOI: 10.1016/j.cell.2019.06.021

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0802700`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os11g0137000`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os12g0133800`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os06g0232300`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033219 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0071944 cell periphery Cellular Component

GO:0010329 auxin efflux transmembrane transporter activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0802700

dosa:Os11g0137000

dosa:Os12g0133800

osa:4351432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.559

Rank 1 · LXL04_033219 · OH-1004

Endoplasmic reticulum0.174

Rank 2 · LXL04_033219 · OH-1004

Lysosome / Vacuole0.169

Rank 3 · LXL04_033219 · OH-1004

Cytoplasm0.075

Rank 4 · LXL04_033219 · OH-1004

Golgi apparatus0.067

Rank 5 · LXL04_033219 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03547.24Mem_trans100-521 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033219	`PF03547.24`	Mem_trans	100	521	9.9e-101	337.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWZ6`	Arabidopsis thaliana	Auxin efflux carrier component 4	72.222%	Swiss-Prot	weak database homology
`Q5VQY3`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 9	34.812%	Swiss-Prot	moderate database homology
`P0C0X5`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1b	69.136%	Swiss-Prot	weak database homology
`Q0IQA5`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1d	69.136%	Swiss-Prot	weak database homology
`Q67UL3`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1c	52.720%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card