LXL04_033160 | RubberDandelionOmics

Gene overview

LXL04_033160

Reference: OH-1004 Chr: Chr07 Coordinates: 37385595-37387730 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · LXL04_033160|LXL04_033160|OH1004|cDNA

ATGGCTGTGCCAATGAGATATTCTCTGTTGTTGATGCTTATCATGATGCCGTTTTCTTCGTTAGCCTCATCATCCGAGACGTGTCCTCAAATCAAGCCATTTCTTCGTGATCTACAGCTTCAATGCCCTACGACGATTATGTATTCTTGGCCGATCAAGATGAACGAGGAGTCTCTGGACAATCTTTTGAGCTCCATTAATCCGAATGAATATGTATCCATTTTGTTCTATTCTTCTTCATGTCCATTTTCCAGCAATTT...

CDS

Download CDS FASTA

849 bp · LXL04_033160|LXL04_033160|OH1004|CDS

ATGGCTGTGCCAATGAGATATTCTCTGTTGTTGATGCTTATCATGATGCCGTTTTCTTCGTTAGCCTCATCATCCGAGACGTGTCCTCAAATCAAGCCATTTCTTCGTGATCTACAGCTTCAATGCCCTACGACGATTATGTATTCTTGGCCGATCAAGATGAACGAGGAGTCTCTGGACAATCTTTTGAGCTCCATTAATCCGAATGAATATGTATCCATTTTGTTCTATTCTTCTTCATGTCCATTTTCCAGCAATTT...

Protein

Download Protein FASTA

282 aa · LXL04_033160|LXL04_033160|OH1004|PROTEIN

MAVPMRYSLLLMLIMMPFSSLASSSETCPQIKPFLRDLQLQCPTTIMYSWPIKMNEESLDNLLSSINPNEYVSILFYSSSCPFSSNFQLKFEALTSMFPQINHVMVDQSSIPPIVFSRFGVHGVPSILIVNKTTKTRYHGPKELHSLVHFYKKATGLEPLIDLTQYQTENKSKVIESIPKTDPFLIFSLFFIFLKTLIYLYPNMVSDFITLWSTYIPHLNLAIFGESRQLLARVFHLVDLKRAFSSFHKLKVVKSSNFDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033160`
TK1151 ID	TkA08G235990
OH-1004 ID	LXL04_033160
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033160

Location Chr07:37385595-37387730 (+)

Description Similar to APRL5: 5'-adenylylsulfate reductase-like 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03860`	5'-adenylylsulfate reductase-like 5.	No verified direct reference in this release
`At5g18120`	5'-adenylylsulfate reductase-like 7.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0806500`	5'-adenylylsulfate reductase-like 5.	No verified direct reference in this release
`Os12g0541600`	5'-adenylylsulfate reductase-like 6.	No verified direct reference in this release
`Os02g0754900`	5'-adenylylsulfate reductase-like 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033160 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT3G03860

ath:AT5G18120

dosa:Os02g0754900

dosa:Os03g0806500

osa:9269513

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.555

Rank 1 · LXL04_033160 · OH-1004

Nucleus0.161

Rank 2 · LXL04_033160 · OH-1004

Golgi apparatus0.143

Rank 3 · LXL04_033160 · OH-1004

Cell membrane0.115

Rank 4 · LXL04_033160 · OH-1004

Cytoplasm0.104

Rank 5 · LXL04_033160 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27914.1APRL7_C178-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033160	`PF27914.1`	APRL7_C	178	246	5.7e-24	84.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YX4`	Arabidopsis thaliana	5'-adenylylsulfate reductase-like 5	41.275%	Swiss-Prot	moderate database homology
`Q84JN1`	Arabidopsis thaliana	5'-adenylylsulfate reductase-like 7	42.529%	Swiss-Prot	moderate database homology
`Q84M47`	Oryza sativa subsp. japonica	5'-adenylylsulfate reductase-like 5	38.521%	Swiss-Prot	moderate database homology
`Q2QP53`	Oryza sativa subsp. japonica	5'-adenylylsulfate reductase-like 6	37.121%	Swiss-Prot	moderate database homology
`Q84P95`	Oryza sativa subsp. japonica	5'-adenylylsulfate reductase-like 3	29.568%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card