LXL04_033159 | RubberDandelionOmics

Gene overview

LXL04_033159

Reference: OH-1004 Chr: Chr07 Coordinates: 37382930-37384664 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · LXL04_033159|LXL04_033159|OH1004|cDNA

ATGAGAGCAGTCGCCGTTGCCGCTGCCGCCACAGCAGCTAAAGCTACAAGTCTTTCTGGAAGACGTTATTCTCATTCGTTTTCCTCAATTCGTGGCTACTCTATCATGATCTCGACACAGCTCAACAACACCAGTGTAACTCACTCTCAGTCGTCGACTTATTCCGCCGACCGATGTTCTCCGTATCGCCAGCTTCTTGCCAACCCATGGTTCGCTAATCAGATCCGATTCGCCAAAGCTCGCGGCTCCGATGTGAGACC...

CDS

Download CDS FASTA

804 bp · LXL04_033159|LXL04_033159|OH1004|CDS

ATGAGAGCAGTCGCCGTTGCCGCTGCCGCCACAGCAGCTAAAGCTACAAGTCTTTCTGGAAGACGTTATTCTCATTCGTTTTCCTCAATTCGTGGCTACTCTATCATGATCTCGACACAGCTCAACAACACCAGTGTAACTCACTCTCAGTCGTCGACTTATTCCGCCGACCGATGTTCTCCGTATCGCCAGCTTCTTGCCAACCCATGGTTCGCTAATCAGATCCGATTCGCCAAAGCTCGCGGCTCCGATGTGAGACC...

Protein

Download Protein FASTA

267 aa · LXL04_033159|LXL04_033159|OH1004|PROTEIN

MRAVAVAAAATAAKATSLSGRRYSHSFSSIRGYSIMISTQLNNTSVTHSQSSTYSADRCSPYRQLLANPWFANQIRFAKARGSDVRPGNVIERKGKVYQVVKAQHSTQGRGGAIIQVELRDVDSGNKVNERFRTDETVEKIYVEAKSFTYLYTDEETDSIVLMEPNTFVQLDVPKHLFGDSLPYLKDDVKVSVELFNDRPMSASVPKRVTCTVVEAQVPMKGMGATPHTKKAVLDNGLSLQVPPHVVTGDQILVDTTDNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033159`
TK1151 ID	TkA08G235960
OH-1004 ID	LXL04_033159
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.623 / OH-1004 98.876 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_033159`
Location	Chr07:37382930-37384664 (-)
Description	Similar to efp: Elongation factor P (Erythrobacter litoralis (strain HTCC2594)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033159` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0043043 peptide biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0003746 translation elongation factor activity Molecular Function
KEGG gene cross-reference	eli:ELI_05265 nar:Saro_1958 sal:Sala_1314 swi:Swit_2980 zmo:ZMO0328 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.620

Rank 1 · LXL04_033159 · OH-1004

Mitochondrion0.398

Rank 2 · LXL04_033159 · OH-1004

Nucleus0.016

Rank 3 · LXL04_033159 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_033159 · OH-1004

Extracellular0.007

Rank 5 · LXL04_033159 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08207.19EFP_N83-138 aa

PF01132.28EFP143-202 aa

PF09285.18Elong-fact-P_C209-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033159	`PF08207.19`	EFP_N	83	138	9.8e-21	74.2
LXL04_033159	`PF01132.28`	EFP	143	202	2e-13	50.7
LXL04_033159	`PF09285.18`	Elong-fact-P_C	209	264	6.1e-17	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card